Align 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 (uncharacterized)
to candidate WP_009547444.1 CCE_RS14765 3-dehydroquinate synthase
Query= curated2:A6Q3Y3 (349 letters) >NCBI__GCF_000017845.1:WP_009547444.1 Length = 440 Score = 92.0 bits (227), Expect = 3e-23 Identities = 72/253 (28%), Positives = 114/253 (45%), Gaps = 19/253 (7%) Query: 65 EDYKNQETLDFLLDRLFDHKLD--RKSVLIAFGGGVIGDMTGFAASVFQRGIDFIQIPTT 122 E K +T+ LL L D R ++ GGGV+ D+ G A ++ R +I I TT Sbjct: 120 ESDKTPQTVHNLLAFLGKDGCDVSRNEPVLVIGGGVLSDVAGLACALQHRRTPYIMIGTT 179 Query: 123 LLSQVDASVGGKTGINNRFGKNLIGAFHQPKAVYIDTHFLQTLPQREFSAGVAEIVKMAV 182 +++ +DA +T N KN +G +H P +D F +TL G+AEI+KMAV Sbjct: 180 VVAAIDAGPSPRTCTNGSQFKNSMGVYHPPVLTLVDRTFFRTLDTGHIRNGMAEIIKMAV 239 Query: 183 VFDKDFFEWLMKNDLKEEDNLKYAIKRSVELK--------AAIVAKDEREGGVRASL--- 231 D F+ + + + + ++ EL+ A+ + + EG Sbjct: 240 TDDAILFQLMEEYGTRLLETHFATLEGDEELEKIADEVIYRALFSYMKHEGTNMFETYQD 299 Query: 232 ---NYGHTFAHVIENETGYKRFLHGEAVAIGMVMANELAVKTGLLSREDAEKIKNLLQRY 288 YGHT++ E + +HG AV+IGM LA + G LS ED ++I L Sbjct: 300 RPHAYGHTWSPRFEPAA---KLMHGHAVSIGMAFGASLATEMGWLSSEDRDRIIALCSSI 356 Query: 289 NLPVCYEVEDPED 301 L V + + + D Sbjct: 357 GLSVFHPIIEDMD 369 Lambda K H 0.321 0.140 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 285 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 349 Length of database: 440 Length adjustment: 31 Effective length of query: 318 Effective length of database: 409 Effective search space: 130062 Effective search space used: 130062 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory