Align shikimate kinase (EC 2.7.1.71) (characterized)
to candidate WP_009544198.1 CCE_RS06525 shikimate kinase
Query= BRENDA::A0A0M3KL09 (179 letters) >NCBI__GCF_000017845.1:WP_009544198.1 Length = 189 Score = 112 bits (280), Expect = 4e-30 Identities = 69/164 (42%), Positives = 95/164 (57%), Gaps = 1/164 (0%) Query: 10 NIYLVGPMGAGKTTVGRHLAELLGREFLDSDHEIERKTGATIPWIFEKEGEVGFRTRETV 69 N++L+G MG GKTTVG+ LA+ L F DSD IER T I IF +GE FR E+ Sbjct: 12 NVFLIGMMGTGKTTVGQKLAQRLNYRFFDSDVLIERVTQQRISDIFATQGEETFRELESQ 71 Query: 70 VLNELTSRKALVLATGGGAITQAPNREFLKQRGIVVYLYTPVELQLQRTYRDKNRPLLQV 129 VL+EL S V+ATGGG I + N +L G++V+L PV + +R +DK RPLLQ Sbjct: 72 VLSELASCTKSVIATGGGIILKPINWSYL-HHGLIVWLDAPVPILTKRLKKDKTRPLLQQ 130 Query: 130 ENPEQKLRDLLKIRDPLYREVAHYTIETNQGAARDLAQKILQLI 173 + KL+ LL+ R LY + I D+ ++IL+L+ Sbjct: 131 TDLSLKLQSLLEERRYLYAQCDLQIIIDEYQTPDDIVEQILELV 174 Lambda K H 0.318 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 88 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 179 Length of database: 189 Length adjustment: 19 Effective length of query: 160 Effective length of database: 170 Effective search space: 27200 Effective search space used: 27200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory