Align Homoserine kinase; HK; HSK; EC 2.7.1.39 (uncharacterized)
to candidate WP_009546592.1 CCE_RS02445 homoserine kinase
Query= curated2:B2J7E8 (304 letters) >NCBI__GCF_000017845.1:WP_009546592.1 Length = 305 Score = 389 bits (999), Expect = e-113 Identities = 194/300 (64%), Positives = 230/300 (76%), Gaps = 2/300 (0%) Query: 4 VSAITVTVPATTANLGPGFDCIGAALKLYNEFRFTRLEEGG--LIIHVSGTEAERVQTDE 61 +S +TVTVPATTAN+GPGFDCIGAAL LYN+F FT E L I V+GTEA RV D Sbjct: 1 MSTVTVTVPATTANIGPGFDCIGAALTLYNQFTFTEQPEADTDLRITVTGTEAHRVSGDR 60 Query: 62 SNLLYQAFVKFYQHIEQTPPTVKIEIKLGVPLARGLGSSATAIVGGLVAANQLEGATLSQ 121 +NLLYQAF Y H+ +TPP + I+IKLGVPLARGLGSSATAI+GGLV AN+L G LS Sbjct: 61 TNLLYQAFTHLYDHLNKTPPKIAIDIKLGVPLARGLGSSATAIIGGLVGANELAGQPLST 120 Query: 122 SQVMELAIAMEGHPDNVVPALLGGCRLAATSGTAWEICDVPWHKDVVPVVAIPNFELSTS 181 +++MELAIA+EGHPDNVVPALLG C+L+ WEIC +PWH D++PVVAIP+FELST Sbjct: 121 AEIMELAIAIEGHPDNVVPALLGNCQLSVGEAENWEICQIPWHSDIIPVVAIPDFELSTE 180 Query: 182 EARGVLPTEVSRADAIFNTAHLGLLLRGLETGNGQWLKTALQDKLHQPYRKALIPSYDAV 241 EAR VLP +S DAIFN A +GLL+R LE+GN QWL A+ DKLHQPYR+ LI Y+ V Sbjct: 181 EARAVLPKTLSYGDAIFNIARMGLLIRALESGNEQWLNKAMADKLHQPYRQGLIEGYEFV 240 Query: 242 NIAAVSAGAYGMVISGAGPTLLALADQLHSEAVEAAMLAAWQEEGITAEVRSLSLDTQGA 301 +A+ AGAYGMVISGAGPTLLAL ++VE AM AW + I A+VRSLS+DTQGA Sbjct: 241 QASALKAGAYGMVISGAGPTLLALTHPEKIQSVEKAMKNAWTQLEIVADVRSLSIDTQGA 300 Lambda K H 0.317 0.132 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 324 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 304 Length of database: 305 Length adjustment: 27 Effective length of query: 277 Effective length of database: 278 Effective search space: 77006 Effective search space used: 77006 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate WP_009546592.1 CCE_RS02445 (homoserine kinase)
to HMM TIGR00191 (thrB: homoserine kinase (EC 2.7.1.39))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00191.hmm # target sequence database: /tmp/gapView.3147.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00191 [M=304] Accession: TIGR00191 Description: thrB: homoserine kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-96 307.2 0.0 5.1e-96 307.0 0.0 1.0 1 lcl|NCBI__GCF_000017845.1:WP_009546592.1 CCE_RS02445 homoserine kinase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000017845.1:WP_009546592.1 CCE_RS02445 homoserine kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 307.0 0.0 5.1e-96 5.1e-96 1 302 [. 4 303 .. 4 305 .] 0.96 Alignments for each domain: == domain 1 score: 307.0 bits; conditional E-value: 5.1e-96 TIGR00191 1 lkvkvPassANlgpGfDvlGlalslvlellvtedvaqeskdksleaegegvekipkesdkNliyqvakk 69 ++v+vPa++AN+gpGfD++G+al+l+++++ te+ + +++ ++ +g ++++++ + + Nl+yq++++ lcl|NCBI__GCF_000017845.1:WP_009546592.1 4 VTVTVPATTANIGPGFDCIGAALTLYNQFTFTEQPEADTDL-RITVTGTEAHRVSGD-RTNLLYQAFTH 70 689******************************55555555.5************99.9********** PP TIGR00191 70 vlkklgkrvkpvkltvekeiplgrGLGSSaaaivaaviaanelaglklskeelldlalllEgHpDNvap 138 ++++l+k ++ +++ ++ +pl+rGLGSSa+ai+++++ anelag++ls++e+++la+++EgHpDNv p lcl|NCBI__GCF_000017845.1:WP_009546592.1 71 LYDHLNKTPPKIAIDIKLGVPLARGLGSSATAIIGGLVGANELAGQPLSTAEIMELAIAIEGHPDNVVP 139 ********************************************************************* PP TIGR00191 139 allGGlqlavkeddllevlkvPsgsklkvvlviPnievsTaeaRavLPkaysrqdlvfnlshlavlvtA 207 allG +ql+v e ++ e+ ++P +s++ v++iP +e+sT+eaRavLPk s+ d++fn +++++l+ A lcl|NCBI__GCF_000017845.1:WP_009546592.1 140 ALLGNCQLSVGEAENWEICQIPWHSDIIPVVAIPDFELSTEEARAVLPKTLSYGDAIFNIARMGLLIRA 208 ********************************************************************* PP TIGR00191 208 lvskdkadllaiamkDrvhqpyRekliPelteikqaakekgalgitlSGaGptilalaeeek.eekaqe 275 l s+ ++++l++am D++hqpyR+ li +++ ++ a ++ga+g+++SGaGpt+lal++ ek + ++ lcl|NCBI__GCF_000017845.1:WP_009546592.1 209 LESG-NEQWLNKAMADKLHQPYRQGLIEGYEFVQASALKAGAYGMVISGAGPTLLALTHPEKiQSVEKA 276 ****.********************************************************97788888 PP TIGR00191 276 lleklakegieltvkvleldtdgaeve 302 +++ +++ i + v+ l++dt+ga+v lcl|NCBI__GCF_000017845.1:WP_009546592.1 277 MKNAWTQLEIVADVRSLSIDTQGANVN 303 88899999999*************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (305 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.05 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory