Align Threonine synthase; TS; EC 4.2.3.1 (uncharacterized)
to candidate WP_009544859.1 CCE_RS11565 threonine synthase
Query= curated2:Q58860 (405 letters) >NCBI__GCF_000017845.1:WP_009544859.1 Length = 435 Score = 275 bits (702), Expect = 2e-78 Identities = 156/380 (41%), Positives = 223/380 (58%), Gaps = 6/380 (1%) Query: 27 LEIIYDYEEIKDKVSEEKLRKREIGVWRYLEYLPVKDESKIVSLCEGGTPLYRCNNLEKE 86 LE+ YDY+ I+ +VS E + +WRY +LPV E+ I + G TPL + L + Sbjct: 44 LEVAYDYDAIRAQVSRETIEAGPNSIWRYKAFLPVNSENPI-DVGTGMTPLVKSTRLARR 102 Query: 87 LGIKELYVKNEGAN-PTGSFKDRGMTVGVTRANELGVEVVGCASTGNTSASLAAYSARSG 145 LG+ LY+KN+ N PT SFKDR ++V +TRA ELG V CASTGN + S AA +A +G Sbjct: 103 LGLNNLYIKNDAVNMPTLSFKDRVVSVALTRAKELGFTTVSCASTGNLANSTAAIAAHAG 162 Query: 146 KKCIVLLPEGKVALGKLAQAMFYGAKVIQVKGNFDDALDMVKQLAKEKLIYLLN-SINPF 204 C V +P A GK+ + Y V+ VKGN+D + ++ +N ++ P+ Sbjct: 163 LDCCVFIPSDLEA-GKVLGTLIYNPTVMAVKGNYDQVNRLCCEVGNTYGWGFVNINLRPY 221 Query: 205 RLEGQKTIAFEICDQLNWQVPDRVIVPVGNAGNISAIWKGFKEFEITGII-DELPKMTGI 263 EG KT+ FE+ +QL W++PD V+ P+ + + I+KGF+EF TG++ D+ + +G Sbjct: 222 YSEGSKTLGFEVAEQLGWKLPDHVVAPLASGSLYTKIYKGFQEFIKTGLVEDKAVRFSGA 281 Query: 264 QADGAKPIVEAFRKRAKDIIPYKNPETIATAIRIGNPVNAPKALDAIYSSGGYAEAVTDE 323 QA+G PI AF K +D + P TIA +I IGNP + ALD + G E+VTD Sbjct: 282 QAEGCSPIASAF-KEGRDFVTPVKPNTIAKSIAIGNPADGYYALDIARKTNGNIESVTDA 340 Query: 324 EIVEAQKLLARKEGIFVEPASASSIAGLKKLLEEGIIDRDERIVCITTGHGLKDPDAAIR 383 EIVE KLLA EGIF E A +++A LKKL+E G ID DE V TG+GLK +A Sbjct: 341 EIVEGIKLLAETEGIFTETAGGTTVAVLKKLVEAGKIDPDETTVVYITGNGLKTQEAVQE 400 Query: 384 ASEEPIKIECDMNVLKRILK 403 +P+ IE ++ +R L+ Sbjct: 401 YIGQPLTIEPKLDSFERALE 420 Lambda K H 0.317 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 493 Number of extensions: 31 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 405 Length of database: 435 Length adjustment: 32 Effective length of query: 373 Effective length of database: 403 Effective search space: 150319 Effective search space used: 150319 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_009544859.1 CCE_RS11565 (threonine synthase)
to HMM TIGR00260 (thrC: threonine synthase (EC 4.2.3.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00260.hmm # target sequence database: /tmp/gapView.2633.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00260 [M=340] Accession: TIGR00260 Description: thrC: threonine synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-107 346.0 0.0 1.4e-107 345.8 0.0 1.0 1 lcl|NCBI__GCF_000017845.1:WP_009544859.1 CCE_RS11565 threonine synthase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000017845.1:WP_009544859.1 CCE_RS11565 threonine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 345.8 0.0 1.4e-107 1.4e-107 1 340 [] 69 396 .. 69 396 .. 0.98 Alignments for each domain: == domain 1 score: 345.8 bits; conditional E-value: 1.4e-107 TIGR00260 1 vvryreilevtekdlvdlaegstelfrspklaeevgaenlyvkelfhg.PtlaFKDrglqfvavlltka 68 ++ry+++l+v+ ++++d+ +g+t+l++s +la+++g++nly+k+++++ Ptl+FKDr+ v+v+lt+a lcl|NCBI__GCF_000017845.1:WP_009544859.1 69 IWRYKAFLPVNSENPIDVGTGMTPLVKSTRLARRLGLNNLYIKNDAVNmPTLSFKDRV---VSVALTRA 134 8*********************************************************...******** PP TIGR00260 69 lelgnetvlcAtsGdtgaaaaealagkanvkvvvLyPkgkispvkeklvtalaenakvlaikGdFDdaq 137 +elg +tv cA++G++++++a a+a++a+++++v++P++ ++ ++k++ +l++n +v+a+kG++D+++ lcl|NCBI__GCF_000017845.1:WP_009544859.1 135 KELGFTTVSCASTGNLANSTA-AIAAHAGLDCCVFIPSD-LE--AGKVLGTLIYNPTVMAVKGNYDQVN 199 *********************.*****************.88..9************************ PP TIGR00260 138 dlvkeifedkeklklnsvNsinparieaqktyafeiveqlgkespdkvvvpvp.sgnfgailkGflekk 205 +l++e+ + + ++++++N++ p++ e++kt+ fe++eqlg++ pd+vv p++ +++ ++i+kGf+e+ lcl|NCBI__GCF_000017845.1:WP_009544859.1 200 RLCCEVG-NTYGWGFVNINLR-PYYSEGSKTLGFEVAEQLGWKLPDHVVAPLAsGSLYTKIYKGFQEFI 266 ******9.899********88.*******************************666779********** PP TIGR00260 206 elg....lpieklaiaaegaadivrrflksgdlepkedkeTlstAmdignpsnveralelarrslgnle 270 ++g + +++++++aeg+++i+ +f++++d+++ +++T++++++ignp++ +al++ar+++gn+e lcl|NCBI__GCF_000017845.1:WP_009544859.1 267 KTGlvedKAVRFSGAQAEGCSPIASAFKEGRDFVTPVKPNTIAKSIAIGNPADGYYALDIARKTNGNIE 335 ****99999************************************************************ PP TIGR00260 271 dlkesvsdeeileaikklaeeegyllephtavavaalkklvekgvsatadpaKFeevvealtgnklkdp 339 ++ +d+ei+e ik+lae+eg+++e++++++va+lkklve+g ++dp+ e++v+++tgn+lk++ lcl|NCBI__GCF_000017845.1:WP_009544859.1 336 SV----TDAEIVEGIKLLAETEGIFTETAGGTTVAVLKKLVEAG---KIDPD--ETTVVYITGNGLKTQ 395 **....**************************************...*****..*************98 PP TIGR00260 340 e 340 e lcl|NCBI__GCF_000017845.1:WP_009544859.1 396 E 396 7 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (340 nodes) Target sequences: 1 (435 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 12.06 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory