Align fused D-3-phosphoglycerate dehydrogenase / phosphoserine phosphatase (EC 1.1.1.95; EC 3.1.3.3) (characterized)
to candidate YP_002827271.1 NGR_c27700 D-3-phosphoglycerate dehydrogenase
Query= reanno::Cola:Echvi_2777 (630 letters) >NCBI__GCF_000018545.1:YP_002827271.1 Length = 531 Score = 207 bits (526), Expect = 1e-57 Identities = 128/338 (37%), Positives = 181/338 (53%), Gaps = 13/338 (3%) Query: 235 VLLLENVHPIGVEIMKQEGYNVEVVSS-AMSEEELCEKIKNVSIIGIRSKTQITKKVLEN 293 VL+ + + V+I + G V+ +E+L E I N + IRS T++T+K++ Sbjct: 5 VLVSDELSETAVQIFRDRGVEVDFQPKLGKDKEKLAEIIGNYDGLAIRSATKVTEKLIAE 64 Query: 294 ANRLMAVGAFCIGTNQIDLETCQEKGIAVFNAPFSNTRSVVELAISEIIFLMRNLHDKTL 353 A L VG IG + +D+ +GI V N PF N+ + E AI+ + + R L Sbjct: 65 ATNLKVVGRAGIGVDNVDIPAASRRGIIVMNTPFGNSITTAEHAIALMFAVARQLPAADN 124 Query: 354 KMHQGIWNKSASGSFEVRGKKLGIIGYGNIGAQLSVLAENMGMNVFYYD---IVERLALG 410 G W KS E+ GK LG+IG GNIG+ + A + M+V YD ER Sbjct: 125 STQAGKWEKSKFMGVEITGKVLGVIGAGNIGSIVCARAIGLKMHVLAYDPFLSKERAEEM 184 Query: 411 NATKIDSLDELLETCDIISLHVDGRTENKNILNKEKIFKMKKGAILVNLSRGHVVDVPAL 470 K++ LDELL D I+LHV + +NIL+ E + K K G +VN +RG +VD AL Sbjct: 185 GVVKVE-LDELLAQADFITLHVPLTDKTRNILSAEALAKTKPGVRIVNCARGGLVDEKAL 243 Query: 471 RDALESGHLAGAAVDVFPTEPKNNDEPFESELIGCPNTILTPHIGGSTLEAQENIAQFVP 530 DAL+SGH+AGA DVF EP ES L G PN + TPH+G ST EAQEN+A V Sbjct: 244 ADALKSGHVAGAGFDVFEVEPAT-----ESPLFGLPNVVCTPHLGASTTEAQENVALQVA 298 Query: 531 GKIIEYINSGNTFNSVNFPNI---QLPFLKDAHRLIHI 565 ++ +Y+ G N++N P+I + P LK RL + Sbjct: 299 EQMADYLVKGAVSNAINMPSITAEEAPILKPVIRLADV 336 Lambda K H 0.317 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 694 Number of extensions: 38 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 630 Length of database: 531 Length adjustment: 36 Effective length of query: 594 Effective length of database: 495 Effective search space: 294030 Effective search space used: 294030 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory