Align branched-chain-amino-acid transaminase (EC 2.6.1.42) (characterized)
to candidate YP_002825273.1 NGR_c07270 aminotransferase
Query= BRENDA::F2L0W0 (295 letters) >NCBI__GCF_000018545.1:YP_002825273.1 Length = 293 Score = 124 bits (311), Expect = 3e-33 Identities = 84/276 (30%), Positives = 137/276 (49%), Gaps = 9/276 (3%) Query: 4 WLDGRLVDEEEAKVTVLSPSLNYGFGVFEGIRAYWNGENLYVFRLRDHMERLLRSAKIIG 63 ++DG + + S ++ G VF+G R +++G L H +R+ RSA+ +G Sbjct: 14 YVDGEWLSGNPPLIGPTSHAMWLGSTVFDGAR-WFDG---IAPDLDLHCQRVNRSAQALG 69 Query: 64 LDVPYTAEELSKAVVETVRANGFKEDLYIRPV---AYISKPQISLDVRGLQASVAIAAIP 120 L AEE+ E V+ K LY++P+ + S +++D + ++ + P Sbjct: 70 LKPTMAAEEIEALTFEGVKKFDGKTALYVKPMYWGEHGSWSVVAVDPESTRFALCLFEAP 129 Query: 121 FGKYLKVEGVRAAVVSWRRVHTSMMPVMAKATGIYLNSIMAAVEARARGYDEAIMLNAEG 180 G G + +RR MP AKA +Y N+ EAR+RG+D A++ + G Sbjct: 130 MGN--AHAGSALTLSPFRRPTLECMPTDAKAGCLYPNNARILQEARSRGFDNALVRDMLG 187 Query: 181 KVVEGSGENIFIVRRGVLMTPPLEDGILEGITRETVISIAGDLGIPLLEKSITREELYAA 240 + E NIF+VR GV+ TP L GITR VI + + G ++E ++T + AA Sbjct: 188 NIAETGSSNIFMVRDGVVFTPAANRTFLAGITRSRVIGLLREAGFEVIEATLTMTDFEAA 247 Query: 241 DEAFFVGTAAEITPIIEIDGRVLQRGPITQKIAETY 276 DE F G +++ P+ +D R LQ GPI+ K + Y Sbjct: 248 DEMFTTGNYSKVVPVTRLDDRDLQPGPISAKTRDLY 283 Lambda K H 0.320 0.138 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 217 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 293 Length adjustment: 26 Effective length of query: 269 Effective length of database: 267 Effective search space: 71823 Effective search space used: 71823 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory