Align Branched-chain amino acid aminotransferase (EC 2.6.1.42) (characterized)
to candidate YP_002828025.1 NGR_c35490 branched-chain amino acid aminotransferase
Query= reanno::Cup4G11:RR42_RS25890 (363 letters) >NCBI__GCF_000018545.1:YP_002828025.1 Length = 365 Score = 447 bits (1150), Expect = e-130 Identities = 215/354 (60%), Positives = 264/354 (74%), Gaps = 1/354 (0%) Query: 6 TFSLEPNPNALDAATRDALMRDPAFGRVFTDHMVTITWREGQGWQDAKVTARKPFSIDPA 65 TF E +P+ + A+ R+AL+++P FGRV TDHM TI + EG+GW DAK+ RK F + P+ Sbjct: 8 TFLFETHPSPMAASEREALLQNPGFGRVLTDHMATIRYSEGRGWHDAKIEPRKAFELSPS 67 Query: 66 CSVLHYGQEIFEGMKAYRGADGAVTLFRPLENARRFQASAKRMAMPALPESLFLEAIEQL 125 VLHY QEIFEGMKAYR DG TLFRP NARRF SA R+AM LPE LF+E++ L Sbjct: 68 TVVLHYAQEIFEGMKAYRLPDGGATLFRPDANARRFTNSANRLAMAPLPEDLFVESVRAL 127 Query: 126 VRIDQAWVPHGSG-SLYLRPFMFANEVFLGIKPASEFIFCVIACPVGPYFKGGDKAVSVW 184 VR D+ W+P G SLYLRPFM A E LG+KP+S++++CVIA PVG YFKGG AV++W Sbjct: 128 VRTDRDWIPAAEGASLYLRPFMIATEAILGVKPSSDYLYCVIASPVGSYFKGGAPAVTLW 187 Query: 185 VSENYTRAAPGGTGEAKCGGNYAGSLVAQNEATANGCDQVVFLDAAEHRWVEELGGMNIF 244 VSENYTRAAPGGTGEAKCGGNYA SL AQ EAT GCDQVVFLDA E RW+EELGGMN+F Sbjct: 188 VSENYTRAAPGGTGEAKCGGNYAASLAAQAEATREGCDQVVFLDAVEKRWIEELGGMNVF 247 Query: 245 FVMDDGTLVTPPLSGSILPGITRASVIELAREMGMVVEERRYSYPEWEADAKSGRLAEAF 304 FV +DG+L TPPL+G+ILPGITR S+I LAR++G+ V E YS +W+ADA+SGRL EAF Sbjct: 248 FVFEDGSLQTPPLTGTILPGITRDSLITLARDLGLTVREEPYSIDQWQADAESGRLTEAF 307 Query: 305 VCGTAATLVAIGEVRSARTRFAIGNGTAGNTVKVLRDRLVEIQRNQAAGPAGWV 358 CGTAA + IG+V+ F IG+G AG L+ L++IQ +A GW+ Sbjct: 308 ACGTAAVVTPIGKVKGRTRNFTIGDGGAGPVAARLKATLLDIQNGRAPDRHGWL 361 Lambda K H 0.321 0.135 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 449 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 365 Length adjustment: 29 Effective length of query: 334 Effective length of database: 336 Effective search space: 112224 Effective search space used: 112224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
Align candidate YP_002828025.1 NGR_c35490 (branched-chain amino acid aminotransferase)
to HMM TIGR01123 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01123.hmm # target sequence database: /tmp/gapView.23284.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01123 [M=313] Accession: TIGR01123 Description: ilvE_II: branched-chain amino acid aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-129 417.3 0.0 1.9e-129 417.1 0.0 1.0 1 lcl|NCBI__GCF_000018545.1:YP_002828025.1 NGR_c35490 branched-chain amino Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000018545.1:YP_002828025.1 NGR_c35490 branched-chain amino acid aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 417.1 0.0 1.9e-129 1.9e-129 1 311 [. 51 362 .. 51 364 .. 0.99 Alignments for each domain: == domain 1 score: 417.1 bits; conditional E-value: 1.9e-129 TIGR01123 1 WdeaelaseaeleldegsavlhYgqevfeGlkayRtadGkillfRpdanakRlrrsaerlllPeleeel 69 W++a++++ +++el++++ vlhY+qe+feG+kayR dG ++lfRpdana+R+ +sa+rl++ l+e+l lcl|NCBI__GCF_000018545.1:YP_002828025.1 51 WHDAKIEPRKAFELSPSTVVLHYAQEIFEGMKAYRLPDGGATLFRPDANARRFTNSANRLAMAPLPEDL 119 ********************************************************************* PP TIGR01123 70 flealkqlvkadkdwvpkakseasLYlRPfliatednlGvkaakeylflvlasPvGaYfkgglapvsif 138 f+e+++ lv++d+dw+p a+ +asLYlRPf+iate+ lGvk++++yl++v+asPvG+Yfkgg v+ + lcl|NCBI__GCF_000018545.1:YP_002828025.1 120 FVESVRALVRTDRDWIPAAE-GASLYLRPFMIATEAILGVKPSSDYLYCVIASPVGSYFKGGAPAVTLW 187 *****************888.************************************************ PP TIGR01123 139 veteyvRaapkGtGavkvgGnYaasllaqkkaaeqglddvvyldpvekkkieevGaaniflitkdgelv 207 v+++y+Raap+GtG +k+gGnYaasl aq++a+++g+d+vv+ld+vek+ iee+G++n+f++ +dg+l lcl|NCBI__GCF_000018545.1:YP_002828025.1 188 VSENYTRAAPGGTGEAKCGGNYAASLAAQAEATREGCDQVVFLDAVEKRWIEELGGMNVFFVFEDGSLQ 256 ********************************************************************* PP TIGR01123 208 ttplsesiLegvtresllelakdlgleveereiaidelkaaveaGei..vfacGtaavitPvgelkieg 274 t+pl++ iL+g+tr+sl++la+dlgl+v+e+ +id+++a +e+G + +facGtaav+tP+g++k lcl|NCBI__GCF_000018545.1:YP_002828025.1 257 TPPLTGTILPGITRDSLITLARDLGLTVREEPYSIDQWQADAESGRLteAFACGTAAVVTPIGKVKGRT 325 *********************************************9999******************** PP TIGR01123 275 kevevkseevGevtkklrdeltdiqyGkledkegWiv 311 +++++ ++ G+v+ +l+ +l+diq G++ d++gW+ lcl|NCBI__GCF_000018545.1:YP_002828025.1 326 RNFTIGDGGAGPVAARLKATLLDIQNGRAPDRHGWLD 362 ***********************************86 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (313 nodes) Target sequences: 1 (365 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.26 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory