Align Acetolactate synthase large subunit; AHAS; EC 2.2.1.6; Acetohydroxy-acid synthase large subunit; ALS (uncharacterized)
to candidate YP_002822522.1 NGR_b03050 thiamine pyrophosphate protein
Query= curated2:Q7U5G1 (617 letters) >NCBI__GCF_000018545.1:YP_002822522.1 Length = 561 Score = 272 bits (696), Expect = 2e-77 Identities = 183/545 (33%), Positives = 274/545 (50%), Gaps = 21/545 (3%) Query: 22 SGAAALMDALRRHGVDTIFGYPGGAILPIYDALHIAESEGWVKHILVRHEQAGTHAADAY 81 +G L+DALR HGV+ F PG + L DALH A+ + ++ ++ R E + A+AY Sbjct: 9 NGGQILIDALRIHGVERAFCVPGESYLAALDALHEAKDD--IELVVCRQEGGAAYMAEAY 66 Query: 82 ARATGKVGVCFGTSGPGATNLVTGIATAQMDSVPMVVITGQVPRPAIGTDAFQETDIFGI 141 + TGK G+CF T GPGATN G+ TA DS P ++ GQV R + +AFQE D + Sbjct: 67 GKLTGKPGICFVTRGPGATNASVGVHTAFQDSTPTILFIGQVARDQVEREAFQEVDYRRM 126 Query: 142 TLPIVKHSWVVR--DPADLGSIVAQAFLIAASGRPGPVLIDIPKDVGQEQFNYVPVEPGS 199 + K WVV+ D A + +V+QAF A +GRPGP+++ +P+D+ + + Sbjct: 127 FGQMAK--WVVQIDDAARIPELVSQAFHRAVNGRPGPIVVALPEDMLIDCVDVADAPAYK 184 Query: 200 VIPGGFHQPEPPLDAAVAAALDLIEQAQRPLLYVGGGAISACAHDSLRMLAERYQLPVTT 259 + H + LD + +EQA+RP++ VGG + A +R +E +LPV Sbjct: 185 TVE--MHAGQAQLDELRSR----LEQAERPIVIVGGAGWTEDAVADIRSFSEAMRLPVAA 238 Query: 260 TLMGKGAFDENDALSVGMLGMHGTAYANFAVTECDLLIAVGARFDDRVTG---KLDTFAP 316 + + FD G LG+ + + DLLI +GAR + TG +D P Sbjct: 239 SFRCQDLFDNTHPNYAGDLGLAAGPKLIQRIKDSDLLIVIGARLGEMTTGGYSLIDIPVP 298 Query: 317 RARVVHFEIDPAEIGKNRKADVAVLGDLGLSLARMVEISLQRTAEPRTAAWLERINTWKD 376 + +VH E+G+ AD+ + + AR L AEPR A W N Sbjct: 299 KQTLVHVHAGAEELGRVYHADLPINAS-AAAFARQA-AGLAPIAEPRWAEWTRGANA-DY 355 Query: 377 RYPLTIPPAEGAIYPQEVLLAVRDLAP-DAIVTTDVGQHQMWAAQHLRNGPRGWISSAGL 435 R L P G + +++ +RD P DAI+TT G + WA + + Sbjct: 356 RENLEHPAVPGPVQMGDIMAWLRDHLPADAILTTGAGNYSAWAHRFYQYRTFRTQLGPTN 415 Query: 436 GTMGFGMPAAMGAQVAMPDRQVVCIAGDASILMNIQELGTLAAYGLPVKVVIVNNHWQGM 495 G+MG+G+PAA+ A+++ P+R V+ AGD LMN QEL T Y V V+++NN G Sbjct: 416 GSMGYGVPAAIAAKLSAPERPVIAFAGDGCFLMNGQELATAMQYDARVIVLVINNGMYGT 475 Query: 496 VRQWQESFYDERYSASDMLNGMPDFIALARSFGVDGVKITDRELLHRDLAAALQSPTPTM 555 +R QE Y R S + + N PDF ALAR++G+ G + E A QS P + Sbjct: 476 IRMHQERHYPGRVSGTQLTN--PDFAALARAYGLHGETVETTEDFAPAFERAEQSGKPAL 533 Query: 556 IDVHV 560 I+V + Sbjct: 534 IEVRI 538 Lambda K H 0.320 0.136 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 893 Number of extensions: 51 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 617 Length of database: 561 Length adjustment: 37 Effective length of query: 580 Effective length of database: 524 Effective search space: 303920 Effective search space used: 303920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory