Align shikimate dehydrogenase (NADP+) (EC 1.1.1.25); 3-dehydroquinate dehydratase (EC 4.2.1.10) (characterized)
to candidate WP_012386477.1 BIND_RS18160 shikimate dehydrogenase
Query= BRENDA::Q6PUG0 (521 letters) >NCBI__GCF_000019845.1:WP_012386477.1 Length = 284 Score = 118 bits (296), Expect = 2e-31 Identities = 88/271 (32%), Positives = 133/271 (49%), Gaps = 21/271 (7%) Query: 245 LISKPVGHSKGPILHNPTFRHVGYNGIYVPMFV--DDLKEFFRVYSSPDFAGFSVGIPYK 302 +I P+ HS+ P++HN + G G Y + V + L +F R F G +V +P+K Sbjct: 15 VIGYPIKHSRSPLIHNYWLQRYGIAGSYEKIEVAPEHLADFLRDLGGKGFVGANVTLPHK 74 Query: 303 EAVVSFCDEVDPLAKSIGAVNTIIQRPCDGKLIGYNTDCEASITAIEDALKVNGLTNGAA 362 E + CDEV A+ +GAVNT+ R DG+L G+NTD E + A++ + G A Sbjct: 75 ETAFALCDEVSEEARQLGAVNTLFLR--DGRLHGHNTDGEGFLGALDQEVPAWDKDLGKA 132 Query: 363 FLPSPLAGKLFVLVGAGGAGRALAFGAKSRRA-EIVIFDIDFDRAKALAAAVSGEALPFE 421 V++GAGGA RAL F R A EI + + R++ +A G + Sbjct: 133 -----------VIIGAGGAARALVFALLRRGAGEIALVNRTLARSEEIAMQ-GGGRITCH 180 Query: 422 NLASFQP--EKGAILANATPIGMHPNKDRIPVSEASLKDYVVVFDAVYTPRKTTLLKDAE 479 + A + +L NAT +GM ++ + + + L +V D VY P +T LL+ A Sbjct: 181 SYADLPDVLKTADLLVNATSLGM-AGQEPLVIDLSPLPAKAIVDDIVYVPLETDLLRQAR 239 Query: 480 AAGAITVSGVEMFLRQAIGQFHLFTRTKAPE 510 G V G+ M L QA+ F L+ K PE Sbjct: 240 LRGLRRVGGLGMLLHQAVPGFRLWF-GKTPE 269 Lambda K H 0.320 0.138 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 304 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 521 Length of database: 284 Length adjustment: 30 Effective length of query: 491 Effective length of database: 254 Effective search space: 124714 Effective search space used: 124714 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory