Align 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 (uncharacterized)
to candidate WP_012411511.1 NPUN_RS26450 3-dehydroquinate synthase
Query= curated2:A1AQL5 (359 letters) >NCBI__GCF_000020025.1:WP_012411511.1 Length = 400 Score = 154 bits (388), Expect = 5e-42 Identities = 92/267 (34%), Positives = 146/267 (54%), Gaps = 7/267 (2%) Query: 49 LYAEQVRASLVESGNQVTLILIPEGEEHKNAAT-LNLVYDQLIQAGLDRNSYIVALGGGV 107 +YA+ L SG + ++ GE KN + + ++ ++ AGL R+SY++A+GGG Sbjct: 76 VYAQYYENVLTLSGEPIVVL---GGEAVKNHSRFIEQIHQRINAAGLCRHSYVLAIGGGA 132 Query: 108 VGDLAGFAAATFLRGIPFVQVPTTLLAQVDSSVGGKTAIDHPRGKNLIGAFYQPRLVLID 167 V D+ G+AAAT RGI ++VPTT+L Q DS VG K I+ KN +G F P VL D Sbjct: 133 VLDMVGYAAATAHRGIRLLRVPTTVLGQNDSGVGVKNGINAFGKKNFLGTFMPPYAVLND 192 Query: 168 VETLTTLPQREFRAGLAEVIKYGVAMDLAFYELLERDSGRILEMDADCLERIVLRCCELK 227 + LT+L R++R+G+AE +K + D F++ + ++ ++ D D +ER++ RC +L Sbjct: 193 FDFLTSLDDRDWRSGIAEAVKVALIKDADFFDFIMTNADKLANRDMDIMERLIYRCSQLH 252 Query: 228 ARVVE--QDEKESGLRAILNYGHTLGHAIETLAGYGTLVHGEAVAIGMVLAARISLAGGY 285 + D E G L++GH H +E L Y +L HGEAVAIG+ L S G Sbjct: 253 LEHIAGGGDPFEMGSSRPLDFGHWAAHKLEHLTNY-SLRHGEAVAIGIALDTTYSYLTGQ 311 Query: 286 CSEGDVSRIVALLGRFGLPCIPPRIDQ 312 + + ++ L + G P + + Sbjct: 312 LLKSEWQSVLYTLSKLGFTLYVPALTE 338 Lambda K H 0.321 0.140 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 307 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 359 Length of database: 400 Length adjustment: 30 Effective length of query: 329 Effective length of database: 370 Effective search space: 121730 Effective search space used: 121730 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory