Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (characterized)
to candidate WP_012403405.1 BPHY_RS20705 3-deoxy-7-phosphoheptulonate synthase
Query= BRENDA::C3TIE2 (350 letters) >NCBI__GCF_000020045.1:WP_012403405.1 Length = 374 Score = 405 bits (1041), Expect = e-118 Identities = 201/345 (58%), Positives = 252/345 (73%), Gaps = 1/345 (0%) Query: 6 DDLRIKEIKELLPPVALLEKFPATENAANTVAHARKAIHKILKGNDDRLLVVIGPCSIHD 65 DD RI ++ L+ P LL++ P + V +R I IL DDRL+VV+GPCSIHD Sbjct: 26 DDTRIGAVRPLISPALLLDELPCPPDVQTLVEKSRVEIADILHDRDDRLVVVVGPCSIHD 85 Query: 66 PVAAKEYATRLLALREELKDELEIVMRVYFEKPRTTVGWKGLINDPHMDNSFQINDGLRI 125 A EYA +L E L+D+L IVMRVYFEKPRTTVGWKG INDP +D SF+IN+GLR Sbjct: 86 HDQAMEYAHKLRTAAEALRDDLMIVMRVYFEKPRTTVGWKGYINDPRLDGSFRINEGLRR 145 Query: 126 ARKLLLDINDSGLPAAGEFLDMITPQYLADLMSWGAIGARTTESQVHRELASGLSCPVGF 185 AR+LLL+I+ GLP EFLD+++PQY+ADL++WGAIGARTTESQ HR+LASGLSCP+GF Sbjct: 146 ARELLLEISGLGLPTGTEFLDLLSPQYIADLIAWGAIGARTTESQSHRQLASGLSCPIGF 205 Query: 186 KNGTDGTIKVAIDAINAAGAPHCFLSVTKWGHSAIVNTSGNGDCHIILRGGKE-PNYSAK 244 KNGTDG +++A DAI AA A H F+ +TK G +AI T GN D H+ILRGGK+ PNY A Sbjct: 206 KNGTDGGVQIAADAIVAAAASHAFMGMTKMGMAAIFETRGNDDAHVILRGGKKGPNYDAA 265 Query: 245 HVAEVKEGLNKAGLPAQVMIDFSHANSSKQFKKQMDVCADVCQQIAGGEKAIIGVMVESH 304 V E L K GL QVM+D SHANS+K ++Q++V D+ Q++GG+K I+GVM+ESH Sbjct: 266 GVEEACTALRKVGLREQVMVDCSHANSNKSHERQIEVAQDLANQLSGGDKRIVGVMIESH 325 Query: 305 LVEGNQSLESGEPLAYGKSITDACIGWEDTDALLRQLANAVKARR 349 L G Q L+ G PLA+G SITDACIGW T+ +L LA AV+ARR Sbjct: 326 LEAGRQDLKPGVPLAHGVSITDACIGWAQTEPVLETLAQAVRARR 370 Lambda K H 0.317 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 410 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 350 Length of database: 374 Length adjustment: 29 Effective length of query: 321 Effective length of database: 345 Effective search space: 110745 Effective search space used: 110745 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_012403405.1 BPHY_RS20705 (3-deoxy-7-phosphoheptulonate synthase)
to HMM TIGR00034 (3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00034.hmm # target sequence database: /tmp/gapView.8952.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00034 [M=342] Accession: TIGR00034 Description: aroFGH: 3-deoxy-7-phosphoheptulonate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-157 509.8 0.0 1.6e-157 509.6 0.0 1.0 1 lcl|NCBI__GCF_000020045.1:WP_012403405.1 BPHY_RS20705 3-deoxy-7-phosphohe Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000020045.1:WP_012403405.1 BPHY_RS20705 3-deoxy-7-phosphoheptulonate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 509.6 0.0 1.6e-157 1.6e-157 1 342 [] 26 370 .. 26 370 .. 0.99 Alignments for each domain: == domain 1 score: 509.6 bits; conditional E-value: 1.6e-157 TIGR00034 1 ddlrivkidelltPeelkakfpltekaaekvaksrkeiadilaGkddrllvviGPcsihdpeaaleyak 69 dd+ri ++ +l++P+ l + p +++++ v+ksr eiadil+ +ddrl+vv+GPcsihd a+eya+ lcl|NCBI__GCF_000020045.1:WP_012403405.1 26 DDTRIGAVRPLISPALLLDELPCPPDVQTLVEKSRVEIADILHDRDDRLVVVVGPCSIHDHDQAMEYAH 94 7999***************************************************************** PP TIGR00034 70 rlkklaeklkddleivmrvyfekPrttvGWkGlindPdlnesfdvnkGlriarkllldlvelglplate 138 +l++ ae l+ddl ivmrvyfekPrttvGWkG indP l++sf++n+Glr ar+lll++ lglp++te lcl|NCBI__GCF_000020045.1:WP_012403405.1 95 KLRTAAEALRDDLMIVMRVYFEKPRTTVGWKGYINDPRLDGSFRINEGLRRARELLLEISGLGLPTGTE 163 ********************************************************************* PP TIGR00034 139 lldtispqyladllswgaiGarttesqvhrelasglslpvgfkngtdGslkvaidairaaaaehlflsv 207 +ld spqy+adl++wgaiGarttesq hr+lasgls+p+gfkngtdG++++a dai aaaa+h f+++ lcl|NCBI__GCF_000020045.1:WP_012403405.1 164 FLDLLSPQYIADLIAWGAIGARTTESQSHRQLASGLSCPIGFKNGTDGGVQIAADAIVAAAASHAFMGM 232 ********************************************************************* PP TIGR00034 208 tkaGqvaivetkGnedghiilrGGkk.pnydaedvaevkeelekaglkeelmidfshgnsnkdykrqle 275 tk G +ai et+Gn+d+h+ilrGGkk pnyda+ v+e++ l+k+gl+e++m+d+sh+nsnk ++rq+e lcl|NCBI__GCF_000020045.1:WP_012403405.1 233 TKMGMAAIFETRGNDDAHVILRGGKKgPNYDAAGVEEACTALRKVGLREQVMVDCSHANSNKSHERQIE 301 ********************************************************************* PP TIGR00034 276 vaesvveqiaeGekaiiGvmiesnleeGnqsl..keelkyGksvtdacigwedteallrklaeavkerr 342 va+++++q++ G+k i+Gvmies+le G+q+l + +l++G+s+tdacigw +te +l+ la+av++rr lcl|NCBI__GCF_000020045.1:WP_012403405.1 302 VAQDLANQLSGGDKRIVGVMIESHLEAGRQDLkpGVPLAHGVSITDACIGWAQTEPVLETLAQAVRARR 370 ********************************656789****************************996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (342 nodes) Target sequences: 1 (374 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.47 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory