Align Chorismate synthase; CS; 5-enolpyruvylshikimate-3-phosphate phospholyase; EC 4.2.3.5 (characterized)
to candidate WP_012465839.1 CLIM_RS04435 chorismate synthase
Query= SwissProt::O66493 (398 letters) >NCBI__GCF_000020465.1:WP_012465839.1 Length = 397 Score = 379 bits (972), Expect = e-109 Identities = 201/397 (50%), Positives = 270/397 (68%), Gaps = 14/397 (3%) Query: 6 LRFLTAGESHGKGLTAILEGIPANLPLSEEEINHELRRRQRGYGRGGRMKIEKDTAEILS 65 +R+LT+GESHG LTAI++G+PA + +++ +I+ +L RRQ+GYGRGGRM IE D AE++S Sbjct: 2 IRYLTSGESHGPALTAIVDGLPAGIDITQNDIDSQLLRRQQGYGRGGRMTIESDKAEVMS 61 Query: 66 GVRFGKTLGSPIALFIRNRDWENWKEKMAIEGEPSPSVVPFTRPRPGHADLSGGIKYNQR 125 G+RFGK++GSPI L IRNRDWENW MA EP + + PRPGHADL+G IKY Sbjct: 62 GIRFGKSIGSPITLLIRNRDWENWTTTMARFEEPVEEIAKISIPRPGHADLAGRIKYGFN 121 Query: 126 DLRNILERASARETAARVAVGAVCKKFLSEFGIKIGSFVVSIG-------QKEVEELKDK 178 D+R ++ER+SARETAARVA G++ + FL GI+IGS+V +IG VEEL Sbjct: 122 DIRPVIERSSARETAARVAAGSLSRVFLKALGIEIGSYVSAIGSAAEPTVNPAVEEL--- 178 Query: 179 SYFANPEKLLSYHEKAEDSELRIPFPEKDEEFKTYIDEVKEKGESLGGVFEVFALNVPPG 238 N + L+ +A+ S +R+ + IDEVK++G++LGG+ E+F VP G Sbjct: 179 --LVNGAECLAL--EADRSSVRMLNKSAEAGAIAAIDEVKKQGDTLGGIIEIFITGVPMG 234 Query: 239 LGSHIQWDRRIDGRIAQAMMSIQAIKGVEIGLGFEAARRFGSQVHDEIGWSEGKGYFRHS 298 LGS++Q DRR+D + A+MSIQAIKG EIG FE +R+ GSQVHDE SE G R + Sbjct: 235 LGSYVQHDRRLDAMLVSALMSIQAIKGAEIGHAFENSRKPGSQVHDEFFLSENTGLERKT 294 Query: 299 NNLGGTEGGITNGMPIVVRVAMKPIPTLKNPLRSVDIETKEEMKAGKERTDIVAVPAASV 358 N GG EG +++G I +R AMKPI +L PL S D+ET + + ER+D AVPAA V Sbjct: 295 NRAGGLEGSMSSGQTIHLRAAMKPISSLVTPLHSFDLETMKPTLSRFERSDTCAVPAAGV 354 Query: 359 VGEAMLAIVLADALLEKLGGDFMEEVKKRFEDYVNHV 395 V EA++A V+A+ALLEKLGGD E+K R E Y +H+ Sbjct: 355 VAEAVVAPVIANALLEKLGGDHFIEIKSRLETYRDHL 391 Lambda K H 0.317 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 422 Number of extensions: 21 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 398 Length of database: 397 Length adjustment: 31 Effective length of query: 367 Effective length of database: 366 Effective search space: 134322 Effective search space used: 134322 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_012465839.1 CLIM_RS04435 (chorismate synthase)
to HMM TIGR00033 (aroC: chorismate synthase (EC 4.2.3.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00033.hmm # target sequence database: /tmp/gapView.29262.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00033 [M=351] Accession: TIGR00033 Description: aroC: chorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-117 378.3 0.2 2e-117 378.0 0.2 1.0 1 lcl|NCBI__GCF_000020465.1:WP_012465839.1 CLIM_RS04435 chorismate synthase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000020465.1:WP_012465839.1 CLIM_RS04435 chorismate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 378.0 0.2 2e-117 2e-117 2 349 .. 3 373 .. 2 375 .. 0.95 Alignments for each domain: == domain 1 score: 378.0 bits; conditional E-value: 2e-117 TIGR00033 2 rlttfGeSHgkalgaiidGlPaglelteediqkelkrRrpgqsrltrmrkEeDeveilsGvfeGkTtGa 70 r++t GeSHg+al+ai+dGlPag+ +t++di ++l rR++g++r+ rm E+D+ e++sG++ Gk G+ lcl|NCBI__GCF_000020465.1:WP_012465839.1 3 RYLTSGESHGPALTAIVDGLPAGIDITQNDIDSQLLRRQQGYGRGGRMTIESDKAEVMSGIRFGKSIGS 71 899****************************************************************** PP TIGR00033 71 PiallikNkd.........vrskdyed..ikelpRPgHadytylkKYgikd.regggrsSaReTaarva 127 Pi+lli+N+d +++e+ + ++pRPgHad++++ KYg++d r ++rsSaReTaarva lcl|NCBI__GCF_000020465.1:WP_012465839.1 72 PITLLIRNRDwenwtttmaRFEEPVEEiaKISIPRPGHADLAGRIKYGFNDiRPVIERSSARETAARVA 140 **********99999876545677777555679************************************ PP TIGR00033 128 aGavakklLketagieivayvvklgeveleeesak.........eiskerldkspvrcpdaeaekemee 187 aG++ + +Lk giei +yv+ +g+ + ++ + e ++d+s vr+++++ae+ + lcl|NCBI__GCF_000020465.1:WP_012465839.1 141 AGSLSRVFLKA-LGIEIGSYVSAIGSAAEPTVNPAveellvngaECLALEADRSSVRMLNKSAEAGAIA 208 ***********.88************766666555577888888788889999**************** PP TIGR00033 188 eidkakkdgdsvGgvvevvvsnvpvglG..eplfdkldaelasallsinAvKgveiGdGFeaasvrGse 254 id++kk+gd++Gg++e+ +++vp glG ++ +++lda+l sal+si+A+Kg eiG+ Fe+ + +Gs+ lcl|NCBI__GCF_000020465.1:WP_012465839.1 209 AIDEVKKQGDTLGGIIEIFITGVPMGLGsyVQHDRRLDAMLVSALMSIQAIKGAEIGHAFENSRKPGSQ 277 ****************************99999************************************ PP TIGR00033 255 anDelvle.ddkirrktnnsGGieGGitnGedirvriavKpiptikkplktvdletkekakatkgRhDp 322 ++De+ l+ +++++rktn+ GG+eG ++ G+ i++r+a+Kpi+++ +pl++ dlet++++ +R+D lcl|NCBI__GCF_000020465.1:WP_012465839.1 278 VHDEFFLSeNTGLERKTNRAGGLEGSMSSGQTIHLRAAMKPISSLVTPLHSFDLETMKPTLSRFERSDT 346 *****999799********************************************************** PP TIGR00033 323 cvvpravpvvEamvalvladallekra 349 c+vp+a++v+Ea+va v+a+allek + lcl|NCBI__GCF_000020465.1:WP_012465839.1 347 CAVPAAGVVAEAVVAPVIANALLEKLG 373 ***********************9976 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (397 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 7.16 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory