Align threonine synthase (EC 4.2.3.1) (characterized)
to candidate WP_012467222.1 CLIM_RS11720 threonine synthase
Query= BRENDA::P00934 (428 letters) >NCBI__GCF_000020465.1:WP_012467222.1 Length = 437 Score = 315 bits (806), Expect = 2e-90 Identities = 175/409 (42%), Positives = 249/409 (60%), Gaps = 8/409 (1%) Query: 1 MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDEMLKLDFVTRSAKILS 60 M ++ + VS +A +GL + GL+ P ++P FS E+ + F + I Sbjct: 1 MIYFSTNKSSTPVSIKKATLEGLAPDGGLYVPSEIPVFSAPEMQLLEDGSFNNIAFAIAR 60 Query: 61 AFIGDEIPQEILEERVRAAFAFPAPVANVESDVGCLELFHGPTLAFKDFGGRFMAQMLTH 120 FI EIP + L + + + + F P+ +E ELF GPTLAFKD+G RF+A++ + Sbjct: 61 KFICGEIPPDQLSDIIDSCYPFETPLVELEKGTFIEELFSGPTLAFKDYGARFLARLTGY 120 Query: 121 IAGD--KPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIE 178 A + K +T+L ATSGDTG+AVA+ F G+ N +VV+LYP GK+S LQE+ T GGN++ Sbjct: 121 FASEERKLITVLVATSGDTGSAVAYGFQGIQNTRVVLLYPSGKVSRLQEQQLTTAGGNVQ 180 Query: 179 TVAIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQICYYFEAVAQL-PQET 237 + + GDFD CQ LVKQAF D ELK L L SANSINISRL+ Q YY A L Q Sbjct: 181 ALEVQGDFDDCQRLVKQAFTDPELKERLTLTSANSINISRLIPQSFYYAWATLHLKAQYG 240 Query: 238 RNQLVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLHDGQWSPKATQATL 297 Q V SVPSGN+G+LTAG+LA+ +G P+ FIAA+N ND+V R+L +G++ P T TL Sbjct: 241 LEQPVFSVPSGNYGNLTAGVLARMMGFPIGHFIAASNANDSVTRYLDEGRYDPHPTIPTL 300 Query: 298 SNAMDVSQPNNWPRVEELFRRKIWQL-KELGYAAVDDETTQQTMREL-KELGYTSEPHAA 355 S AMDV P+N+ R+ + + K++ A+ D+ T T+R++ + GY +PH A Sbjct: 301 STAMDVGNPSNFARLRHFYGNDHHAMGKDITGIAISDDATVATIRDIFRRYGYVIDPHTA 360 Query: 356 VAYRAL---RDQLNPGEYGLFLGTAHPAKFKESVEAILGETLDLPKELA 401 V +RAL R G+ L TAHPAKF E +E L + +++P+ L+ Sbjct: 361 VGFRALEEYRQTSGSRSPGIVLSTAHPAKFLEVIEDALEKEIEIPERLS 409 Lambda K H 0.319 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 411 Number of extensions: 11 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 428 Length of database: 437 Length adjustment: 32 Effective length of query: 396 Effective length of database: 405 Effective search space: 160380 Effective search space used: 160380 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate WP_012467222.1 CLIM_RS11720 (threonine synthase)
to HMM TIGR00260 (thrC: threonine synthase (EC 4.2.3.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00260.hmm # target sequence database: /tmp/gapView.25078.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00260 [M=340] Accession: TIGR00260 Description: thrC: threonine synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-83 265.9 0.0 3.1e-83 265.7 0.0 1.0 1 lcl|NCBI__GCF_000020465.1:WP_012467222.1 CLIM_RS11720 threonine synthase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000020465.1:WP_012467222.1 CLIM_RS11720 threonine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 265.7 0.0 3.1e-83 3.1e-83 24 331 .. 78 398 .. 59 406 .. 0.89 Alignments for each domain: == domain 1 score: 265.7 bits; conditional E-value: 3.1e-83 TIGR00260 24 elfrspklaeevgaenlyvkelfhgPtlaFKDrglqfvavlltkalelgne..tvlcAtsGdtgaaaae 90 + + ++++ e+++ ++ elf+gPtlaFKD g +f+a l +++ + ++ tvl+AtsGdtg+a+a+ lcl|NCBI__GCF_000020465.1:WP_012467222.1 78 SCYPFETPLVELEK-GTFIEELFSGPTLAFKDYGARFLARLTGYFASEERKliTVLVATSGDTGSAVAY 145 55666666667776.89****************************98888877**************** PP TIGR00260 91 alagkanvkvvvLyPkgkispvkeklvtalaenakvlaikGdFDdaqdlvkeife...dkeklklnsvN 156 +++g +n +vv LyP+gk+s ++e+ +t+ +n++ l+++GdFDd+q+lvk++f ke l l s+N lcl|NCBI__GCF_000020465.1:WP_012467222.1 146 GFQGIQNTRVVLLYPSGKVSRLQEQQLTTAGGNVQALEVQGDFDDCQRLVKQAFTdpeLKERLTLTSAN 214 **********************99999***************************9665666******** PP TIGR00260 157 sinparieaqk.tyafeiveqlgkespdkvvvpvpsgnfgailkGflekkelglpieklaiaaegaadi 224 sin++r+ q +ya+ + + ++ v++vpsgn g++++G + ++++g p +iaa +a+d lcl|NCBI__GCF_000020465.1:WP_012467222.1 215 SINISRLIPQSfYYAWATLHLKAQYGLEQPVFSVPSGNYGNLTAG-VLARMMGFP-IGHFIAASNANDS 281 ***********9*******99999999******************.7777777**.67889999999** PP TIGR00260 225 vrrflksgdlepkedkeTlstAmdignpsnverale.larrslgnledlke.svsdeeileaikklaee 291 v+r+l +g +p+ + TlstAmd+gnpsn+ r+ + + + ++d+ ++sd++++ +i+ + ++ lcl|NCBI__GCF_000020465.1:WP_012467222.1 282 VTRYLDEGRYDPHPTIPTLSTAMDVGNPSNFARLRHfYGNDHHAMGKDITGiAISDDATVATIRDIFRR 350 **********************************9954455555556653249**************** PP TIGR00260 292 egyllephtavavaalkklvekg..vs.....atadpaKFeevve.al 331 gy+++phtav+ +al++ + + s +ta+paKF ev+e al lcl|NCBI__GCF_000020465.1:WP_012467222.1 351 YGYVIDPHTAVGFRALEEYRQTSgsRSpgivlSTAHPAKFLEVIEdAL 398 *****************998887662256778***********99555 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (340 nodes) Target sequences: 1 (437 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.85 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory