Align Valine--pyruvate aminotransferase; Alanine--valine transaminase; EC 2.6.1.66 (characterized)
to candidate WP_012466132.1 CLIM_RS05930 pyridoxal phosphate-dependent aminotransferase
Query= SwissProt::P96847 (388 letters) >NCBI__GCF_000020465.1:WP_012466132.1 Length = 402 Score = 151 bits (381), Expect = 4e-41 Identities = 113/371 (30%), Positives = 176/371 (47%), Gaps = 17/371 (4%) Query: 24 AERQRTHG-DLVNLSAGQPSAGAPEPVRAAAAAALHLNQLGYSVALGIPELRDAIAADYQ 82 A + + G D+V+LSAG+P P+ V A A+ Y+ GIPEL+ AI ++ Sbjct: 31 ANKMKAEGKDIVSLSAGEPDFPTPDHVNQAGIDAIKAGFTRYTANSGIPELKKAIQEKFR 90 Query: 83 RRHGITVEPDAVVITTGSSGGFLLAFLACFDAGDRVAMASPGYPCYRNILSALGCEVVEI 142 R + I + + ++++ G FLA GD V + +P + + ++ G E V + Sbjct: 91 RDNAIEFQENQIIVSNGGKQTLANTFLALCQEGDEVIVPAPYWVSFPEMVRLAGAEPVIL 150 Query: 143 PCGPQTRFQPT-AQMLAEIDPPLRGVVVASPANPTGTVIPPEELAAIASWCDASDVRLIS 201 ++ ++ T Q+ A I P + +V+ SP+NPTG V E+ A+ + +V ++S Sbjct: 151 NTTLESDYKITPLQLEAAITPRTKILVLNSPSNPTGAVYSETEVRALMKVLEGRNVFVLS 210 Query: 202 DEVYHGLVYQGAPQTSCAW--QTSRNAVVVNSFSKYYAMTGWRLGWLLVPTVLRRAVDCL 259 DE+Y +VY G S A + +V N SK YAMTGWR+G+L P L A D + Sbjct: 211 DEMYDMIVYGGVRAFSPARIPEMKDWVIVSNGVSKTYAMTGWRIGFLAGPKWLIDACDKI 270 Query: 260 TGNFTICPPVLSQIAAVSAFTPEATAEADGNLASYAINRSLLLDGLRRIGIDRLAPTDGA 319 T P ++Q AAV+A D L + R + + L I R A GA Sbjct: 271 QSQTTSNPNAIAQKAAVAALIGNQQIVEDRRL-EFEKRRDYMYEALNGIPGFRTALPQGA 329 Query: 320 FYVYADVSD---------FTSDSLAFCSKLLADTGVAIAPGIDFDTARGGSFVRISFAGP 370 FY++ +S DS LL + VA PG F +R+S+A Sbjct: 330 FYIFPSISGVLGKTYNGVVMKDSADVAEYLLKEHHVATVPGDAFGAPEN---LRLSYAAS 386 Query: 371 SGDIEEALRRI 381 ++EEA+RRI Sbjct: 387 ISELEEAIRRI 397 Lambda K H 0.321 0.136 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 359 Number of extensions: 12 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 402 Length adjustment: 31 Effective length of query: 357 Effective length of database: 371 Effective search space: 132447 Effective search space used: 132447 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory