Align 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) (characterized)
to candidate WP_012501549.1 CPAR_RS01510 3-phosphoshikimate 1-carboxyvinyltransferase
Query= BRENDA::B8CWX4 (430 letters) >NCBI__GCF_000020505.1:WP_012501549.1 Length = 434 Score = 280 bits (716), Expect = 6e-80 Identities = 175/433 (40%), Positives = 255/433 (58%), Gaps = 17/433 (3%) Query: 12 KGEIN-IPGDKSISHRSVIFTSLAEGRSLIRGFLESEDCLNTLRAFQMMGVNI--EKIKP 68 +GE++ +P DKSISHR+ I SLAEG + I F D +TL + +G+++ +++ Sbjct: 5 QGEVSSLPPDKSISHRAAIIGSLAEGTTEITNFSGGFDNQSTLSVLRDLGISVRQDEVPA 64 Query: 69 GE------YIVNGVGLYGLKEPGDVIDCGNSGTGMRLLCGLLAPQPFYSVLTGDNSLRNR 122 G+ ++ GL+ +EP + + C NSG+ MR++ G+LA QPF S L GD SL R Sbjct: 65 GDGRIVRHVVIESNGLWSFREPSEPLMCNNSGSTMRMMAGILAAQPFRSELVGDASLMKR 124 Query: 123 PMGRVVNPLRQMGASIWCRDGGYAPLSIKGEK-LEGISYTLPVASAQVKSSLLLAGLYSQ 181 PM RV +PLR MGA I D G AP+ I G K L+ I Y LPV SAQVKS + LA L++ Sbjct: 125 PMKRVADPLRMMGADISLSDAGTAPVVINGTKDLKTIEYLLPVPSAQVKSLVALAALHAD 184 Query: 182 GDVFLTEPGPSRDHTERMLKGFGVKVYKKGNSIKLPHSEDTK-LTPQEVLIPGDISSAAF 240 G + EP SRDHTE ML G++ + + ++ + K + + +P D S+A F Sbjct: 185 GQSKIIEPIRSRDHTELML---GLETIDRPDGVREIIIDGRKPIAAKPFKVPADPSAACF 241 Query: 241 FIVASLITPGSEILLKNVGLNPTRCGIIDVVRQMGGNLELLNVREVNGEKSADILVK-YS 299 I L+ SEI+L++V LNPTR IDV+++ G L + NVR GE DI+V+ S Sbjct: 242 MIALGLLGERSEIVLRDVCLNPTRVAYIDVLQEAGAGLGIENVRSEGGEPVGDIVVRSCS 301 Query: 300 ELEGVHI-DGDIIPRLIDEIPVIAVLASQARGETVIRDAAELKVKETDRIKATVTELGKS 358 L + I D ++ +IDE+P++AVL++ A GE + +A EL+ KE+DRI+A V+ L + Sbjct: 302 SLAPLRISDHAVVAGVIDELPMLAVLSAFATGEFELHNATELRTKESDRIEAVVSNLERL 361 Query: 359 GVDIEELPDGMVIKG-PCSIIGGVKLESYKDHRIAMSLAVAGLLAEEQITIKNSECINTS 417 G E+ PDG V+KG P +E + DHRIAMS A+A A + + + E S Sbjct: 362 GFACEQYPDGFVVKGRPTVNREEAVIECFDDHRIAMSFAIAAEAAGASLRLSDREVAGVS 421 Query: 418 FPQFNKLLQKLIQ 430 FP F L++ L Q Sbjct: 422 FPNFFALIESLKQ 434 Lambda K H 0.317 0.138 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 448 Number of extensions: 31 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 430 Length of database: 434 Length adjustment: 32 Effective length of query: 398 Effective length of database: 402 Effective search space: 159996 Effective search space used: 159996 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
Align candidate WP_012501549.1 CPAR_RS01510 (3-phosphoshikimate 1-carboxyvinyltransferase)
to HMM TIGR01356 (aroA: 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01356.hmm # target sequence database: /tmp/gapView.24714.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01356 [M=415] Accession: TIGR01356 Description: aroA: 3-phosphoshikimate 1-carboxyvinyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-109 351.2 0.0 4.3e-109 351.0 0.0 1.0 1 lcl|NCBI__GCF_000020505.1:WP_012501549.1 CPAR_RS01510 3-phosphoshikimate Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000020505.1:WP_012501549.1 CPAR_RS01510 3-phosphoshikimate 1-carboxyvinyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 351.0 0.0 4.3e-109 4.3e-109 4 413 .. 10 433 .. 6 434 .] 0.92 Alignments for each domain: == domain 1 score: 351.0 bits; conditional E-value: 4.3e-109 TIGR01356 4 kipgsKSishRalllaaLaegetvvtnlLkseDtlatlealrklGakve.ee...ke.....elviegv 63 ++p++KSishRa ++++Laeg+t++tn+ + D ++tl++lr+lG++v+ +e ++ ++vie + lcl|NCBI__GCF_000020505.1:WP_012501549.1 10 SLPPDKSISHRAAIIGSLAEGTTEITNFSGGFDNQSTLSVLRDLGISVRqDEvpaGDgrivrHVVIESN 78 58**********************************************943333222222225677777 PP TIGR01356 64 gg..lkepeaeldlgnsGttaRlltgvlalasgevvltgdeslkkRPierlveaLrelgaeieskeeeg 130 g ++ep++ l ++nsG t+R++ g+la++++ ++l gd sl kRP++r+ ++Lr++ga+i+ ++ +g lcl|NCBI__GCF_000020505.1:WP_012501549.1 79 GLwsFREPSEPLMCNNSGSTMRMMAGILAAQPFRSELVGDASLMKRPMKRVADPLRMMGADISLSD-AG 146 768899999******************************************************877.79 PP TIGR01356 131 slPlaisgplkg.givelsgsaSsQyksalllaaplalqavtleivgeklisrpyieitLkllksfgve 198 ++P++i+g++ + i +l + S+Q+ks + laa l+a++ + ++e++ sr+++e++L l lcl|NCBI__GCF_000020505.1:WP_012501549.1 147 TAPVVINGTKDLkTIEYLLPVPSAQVKSLVALAA---LHADGQSKIIEPIRSRDHTELMLGLET----- 207 *********9998999******************...88899999999***********97644..... PP TIGR01356 199 veeede.rkivvkggqkykqkevevegDaSsAafflaaaaitge.evtvenlgenstqgdkaiiivLee 265 +++ d+ r+i++ g + ++ k ++v++D+S+A+f++a++++ ++ e++++++ n+t+ i+vL+e lcl|NCBI__GCF_000020505.1:WP_012501549.1 208 IDRPDGvREIIIDGRKPIAAKPFKVPADPSAACFMIALGLLGERsEIVLRDVCLNPTRVA--YIDVLQE 274 67777779******99988888**********************9*************99..888**** PP TIGR01356 266 mGadveveeqr........dvevegasklkgvkv.d.idvdsliDelptlavlaafAegetriknieel 324 Ga + +e+ r d++v++ s+l ++++ d + v+ +iDelp+lavl+afA ge +++n+ el lcl|NCBI__GCF_000020505.1:WP_012501549.1 275 AGAGLGIENVRseggepvgDIVVRSCSSLAPLRIsDhAVVAGVIDELPMLAVLSAFATGEFELHNATEL 343 *******999999*********************9757899**************************** PP TIGR01356 325 RvkEsdRiaaiaeeLeklGveveeledgllieGkk.kelkgavvdtydDHRiamalavlglaaegevei 392 R kEsdRi+a++++Le+lG +e+ +dg++++G+ + ++av++++dDHRiam++a+++ aa + +++ lcl|NCBI__GCF_000020505.1:WP_012501549.1 344 RTKESDRIEAVVSNLERLGFACEQYPDGFVVKGRPtVNREEAVIECFDDHRIAMSFAIAAEAAGASLRL 412 **********************************8555566**************************** PP TIGR01356 393 edaecvaksfPeFfevleqlg 413 d e++ +sfP+Ff ++e+l+ lcl|NCBI__GCF_000020505.1:WP_012501549.1 413 SDREVAGVSFPNFFALIESLK 433 *****************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (415 nodes) Target sequences: 1 (434 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 8.17 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory