Align aspartate kinase; homoserine dehydrogenase (EC 2.7.2.4; EC 1.1.1.3) (characterized)
to candidate WP_041466196.1 CPAR_RS10150 lysine-sensitive aspartokinase 3
Query= reanno::Pedo557:CA265_RS23475 (817 letters) >NCBI__GCF_000020505.1:WP_041466196.1 Length = 470 Score = 268 bits (685), Expect = 5e-76 Identities = 165/469 (35%), Positives = 276/469 (58%), Gaps = 23/469 (4%) Query: 1 MKVLKFGGTSVGSAENIKTLLRLVGEEKQKNSPVVVLSAMSGVTNLLTEMAEMAERGEDY 60 M V+KFGGTSVG+A ++ ++ + E+K+ ++P+VVLSA SG+TN L ++A+ A G Sbjct: 1 MVVMKFGGTSVGTAAAMRQVIANIAEKKKTSAPLVVLSACSGITNKLIQIADEAGSGRLK 60 Query: 61 DTH--LKEIEAKHFAVIRSLLP-AAAQNPVFTRLKIFFNELEDLLQAVANLRELSLQTKD 117 + + E+ H +I L+ + V ++ ++ LE L + + + EL+ +++D Sbjct: 61 EALKLVGEVRQFHLDLIGELIGNEELRAAVIEKIGVYLTRLERLTEGIEIVGELTERSRD 120 Query: 118 QILSYGERCSTFMISHIASKNIGDSIYVNGSDLIKTDSNFGQAKVETELTEMLINNFYQE 177 + S+GE ST + + ++ +++ ++ TD +G A+ E + Sbjct: 121 RFCSFGELLSTSVFAAALNEAGVPCEWLDVRTVMITDDRYGFARPLAETCRKNTTEIIKP 180 Query: 178 NKDK--VLFVTGFIASNAAGRVTTLGRGGSDYTAAVWGAALNAEEIEIWTDVNGMMTADP 235 D V+ G+I S +GR TTLGRGGSD +AA++GA L++E IEIWTDV+G+MT DP Sbjct: 181 LLDAGTVVVTQGYIGSTESGRTTTLGRGGSDLSAALFGAWLHSESIEIWTDVDGVMTTDP 240 Query: 236 RMVKKAFSLPELSYTEAMELSYFGAKVIYPPTMIPAFMKKIPIVIKNTFEPDFAGTYIKS 295 RMV +A S+ ++++EA EL+Y GAKV++P T+ PA K IP+ + NT+ PD GT I + Sbjct: 241 RMVPEARSIRVMTFSEAAELAYLGAKVLHPDTIAPAVEKNIPVFVLNTWHPDSKGTLITN 300 Query: 296 DV-----KASSLPIKGISSIDHISIINLTGSGMVGKAGFSGRLFSLLSREQINVVLITQS 350 D K+ +K I+ +I+N+ + M G+ GF LF + R I+V +I S Sbjct: 301 DPELLAGKSHGGLVKSIAVKKGQAILNIRSNRMFGRHGFMSELFDVFERFAISVEMI--S 358 Query: 351 SSEHSITFAVKPTDASQAISLIKKEFELELDAKKLELPEVENNLAVLAIVGENMKRTPGM 410 +SE S++ V D S + IK L E+E+ +A +++VG+N++ + G+ Sbjct: 359 TSEVSVSLTV--DDGSVGETFIKA-------LSSLGEVEIEHKVATVSVVGDNLRMSRGV 409 Query: 411 SGRLFNALGRNGINVRAIAQGSSEYNISVIISKDDLSKAVNAVHDAFFT 459 +GR+FN+L +N+R I+QG+SE N+ V++ + D++ AV A+H FFT Sbjct: 410 AGRIFNSL--RNVNLRMISQGASEINVGVVVDESDVAPAVAALHCEFFT 456 Lambda K H 0.316 0.133 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 768 Number of extensions: 39 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 817 Length of database: 470 Length adjustment: 37 Effective length of query: 780 Effective length of database: 433 Effective search space: 337740 Effective search space used: 337740 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory