Align threonine synthase (EC 4.2.3.1) (characterized)
to candidate WP_012503136.1 CPAR_RS09710 threonine synthase
Query= BRENDA::P00934 (428 letters) >NCBI__GCF_000020505.1:WP_012503136.1 Length = 438 Score = 323 bits (829), Expect = 5e-93 Identities = 177/416 (42%), Positives = 255/416 (61%), Gaps = 9/416 (2%) Query: 1 MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDEMLKLDFVTRSAKILS 60 M Y+ + V+ +A +GL + GL+ P ++P FS EI + F + I Sbjct: 1 MIFYSTTKASAPVTMKKATLEGLAPDGGLYVPSEMPRFSAEEISLLESGSFTNIAFAIAK 60 Query: 61 AFIGDEIPQEILEERVRAAFAFPAPVANVESDVGCLELFHGPTLAFKDFGGRFMAQMLTH 120 F+GDEIP + L + F F P+ +++D ELFHGPTLAFKD+G RF+A+M Sbjct: 61 KFVGDEIPLDRLSALIDDCFTFETPLHELDADTFVEELFHGPTLAFKDYGARFLARMTGF 120 Query: 121 IAGDKP--VTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIE 178 A ++ +T+L ATSGDTG+AVA+ F+G+PN +VV+LYP GK+S LQE+ T G N+ Sbjct: 121 YAAEESRMITVLVATSGDTGSAVAYGFHGIPNTRVVLLYPSGKVSHLQEQQLTTAGDNVH 180 Query: 179 TVAIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQICYYFEAVAQLPQETR 238 + + GDFD CQ LVKQAF D+ L+ L L SANSINISRL+ Q YY A QL Q Sbjct: 181 ALEVKGDFDDCQRLVKQAFVDQSLRQKLTLTSANSINISRLIPQSFYYAWAALQLRQHQS 240 Query: 239 NQL-VVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLHDGQWSPKATQATL 297 N L SVPSGN+G+LTAG++AK +G P+ FIAA+N ND+V R+L +G++ P+ T TL Sbjct: 241 NALPTFSVPSGNYGNLTAGVMAKMMGFPIGGFIAASNANDSVTRYLDEGRFEPRPTIKTL 300 Query: 298 SNAMDVSQPNNWPRVEELFRRKIWQL-KELGYAAVDDETTQQTMRELKE-LGYTSEPHAA 355 + AMDV P+N+ R+ + ++ ++ AV D T +T+R + + GY +PH A Sbjct: 301 TTAMDVGNPSNFARLLHFYEGDFRKMGVDIAGIAVSDAETVETIRAVHDRYGYIMDPHTA 360 Query: 356 VAYRAL---RD-QLNPGEYGLFLGTAHPAKFKESVEAILGETLDLPKELAERADLP 407 V YRAL RD + G+ + L TAHP KF E++ G+ + +P+ + + + P Sbjct: 361 VGYRALEHFRDTRSGAGKPAVVLSTAHPVKFDEAIRTATGKEVPIPESMHDIMNKP 416 Lambda K H 0.319 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 457 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 428 Length of database: 438 Length adjustment: 32 Effective length of query: 396 Effective length of database: 406 Effective search space: 160776 Effective search space used: 160776 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate WP_012503136.1 CPAR_RS09710 (threonine synthase)
to HMM TIGR00260 (thrC: threonine synthase (EC 4.2.3.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00260.hmm # target sequence database: /tmp/gapView.20394.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00260 [M=340] Accession: TIGR00260 Description: thrC: threonine synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-87 279.3 0.0 2.8e-87 279.0 0.0 1.1 1 lcl|NCBI__GCF_000020505.1:WP_012503136.1 CPAR_RS09710 threonine synthase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000020505.1:WP_012503136.1 CPAR_RS09710 threonine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 279.0 0.0 2.8e-87 2.8e-87 13 336 .. 67 403 .. 57 407 .. 0.91 Alignments for each domain: == domain 1 score: 279.0 bits; conditional E-value: 2.8e-87 TIGR00260 13 kdlvdlaegstelfrspklaeevgaenlyvkelfhgPtlaFKDrglqfvavl..ltkalelgnetvlcA 79 ++l l + f+++++ +e+ a + +v elfhgPtlaFKD g +f+a + + +a e + tvl+A lcl|NCBI__GCF_000020505.1:WP_012503136.1 67 IPLDRLSALIDDCFTFETPLHELDA-DTFVEELFHGPTLAFKDYGARFLARMtgFYAAEESRMITVLVA 134 666777777888999**********.***********************976448899999999***** PP TIGR00260 80 tsGdtgaaaaealagkanvkvvvLyPkgkispvkeklvtalaenakvlaikGdFDdaqdlvkeifedke 148 tsGdtg+a+a+++ g +n +vv LyP+gk+s ++e+ +t+ n++ l++kGdFDd+q+lvk++f d+ lcl|NCBI__GCF_000020505.1:WP_012503136.1 135 TSGDTGSAVAYGFHGIPNTRVVLLYPSGKVSHLQEQQLTTAGDNVHALEVKGDFDDCQRLVKQAFVDQS 203 *********************************99999***************************9655 PP TIGR00260 149 ...klklnsvNsinparieaqk.tyafeiveqlgkespdkvvvpvpsgnfgailkGflekkelglpiek 213 kl l s+Nsin++r+ q +ya+ +++ +++s+ +++vpsgn g++++G + +k++g p lcl|NCBI__GCF_000020505.1:WP_012503136.1 204 lrqKLTLTSANSINISRLIPQSfYYAWAALQLRQHQSNALPTFSVPSGNYGNLTAG-VMAKMMGFP-IG 270 566*******************9*******99998999999***************.6777777**.67 PP TIGR00260 214 laiaaegaadivrrflksgdlepkedkeTlstAmdignpsnverale....larrslgnledlkesvsd 278 +iaa +a+d v+r+l +g +ep+ + +Tl tAmd+gnpsn+ r+l+ +r+ + ++ + +vsd lcl|NCBI__GCF_000020505.1:WP_012503136.1 271 GFIAASNANDSVTRYLDEGRFEPRPTIKTLTTAMDVGNPSNFARLLHfyegDFRKMGVDIAGI--AVSD 337 889999999*************************************97766678888888888..**** PP TIGR00260 279 eeileaikklaeeegyllephtavavaalkklvekg..vs......atadpaKFeevvealtgnkl 336 +e++e+i+ + + gy+++phtav+++al+ + + +ta+p KF e++ tg++ lcl|NCBI__GCF_000020505.1:WP_012503136.1 338 AETVETIRAVHDRYGYIMDPHTAVGYRALEHFRDTRsgAGkpavvlSTAHPVKFDEAIRTATGKEV 403 ******************************9988765522556678*************9999876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (340 nodes) Target sequences: 1 (438 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 11.90 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory