Align O-acetyl-L-homoserine sulfhydrylase; OAH sulfhydrylase; O-acetylhomoserine thiolase; EC 2.5.1.- (characterized)
to candidate WP_012474093.1 CPHAMN1_RS03220 O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase
Query= SwissProt::Q9WZY4 (430 letters) >NCBI__GCF_000020545.1:WP_012474093.1 Length = 410 Score = 288 bits (737), Expect = 2e-82 Identities = 159/419 (37%), Positives = 249/419 (59%), Gaps = 15/419 (3%) Query: 7 GYNTRALHAGYEPPEQATGSRAVPIYQTTSYVFRDSDHAARLFALEEPGFIYTRIGNPTV 66 G+ T+ LH Y P + G+ P+Y + ++ F ++ + F + P Y+RI NPTV Sbjct: 3 GFTTKVLHTRY-PKKDVHGALRPPLYDSVAFEFENASAIQQAFEGKLPAHTYSRISNPTV 61 Query: 67 SVLEERIAALEEGVGALAVASGQAAITYAILNIAGPGDEIVSGSALYGGTYNLFRHTLYK 126 E ++ AL + G +AV+SG AAIT +L + G IVS L+G T +LF TL Sbjct: 62 EDFETKMRALCDARGVIAVSSGMAAITNVMLALCSAGSNIVSSRHLFGNTVSLFEKTL-G 120 Query: 127 KSGIIVKFVDETDPKNIEEAITEKTKAVYLETIGNPGLTVPDFEAIAEIAHRHGVPLIVD 186 G+ V++ D +P +IE I E T+AVYLE+I NP L V D ++ A + GVPL++D Sbjct: 121 DWGLEVRYADMNNPGSIESMIDEHTRAVYLESITNPQLEVADIAMVSRCAEKAGVPLVLD 180 Query: 187 NTVA-PYIFRPFEHGADIVVYSATKFIGGHGTSIGGLIVDSGKFDWTNGKFPELVEPDPS 245 T+ PY+FR ++ + V S TK+I G T +GG+I+D+G FDW+ + P Sbjct: 181 GTLTTPYLFRSRDYNVAVEVISTTKYISGGATGVGGVIIDNGLFDWSASA---KISP--- 234 Query: 246 YHGVSYVETFKEAAYIAKCRTQLLRDLGSCMSPFNAFLFILGLETLSLRMKKHCENALKI 305 +++ + A++AK R ++ R+ GSCM+P +A++ LGLETL+LR+++ C+NA +I Sbjct: 235 -----FIDRYGPFAFLAKLRREVFRNCGSCMAPHHAWMNTLGLETLALRIRQSCDNAREI 289 Query: 306 VEFLKSHPAVSWVNYPIAEGNKTRENALKYLKEGYGAIVTFGVKGGKEAGKKFIDSLTLI 365 FL P V VNYP + + A K+GYG ++ F ++ K+ +FIDSL +I Sbjct: 290 ARFLAEQPKVKAVNYPGLPESGSHAIAAAQFKKGYGGLLAFELE-NKDQCFRFIDSLGII 348 Query: 366 SHLANIGDARTLAIHPASTTHQQLTEEEQLKTGVTPDMIRLSVGIEDVEDIIADLDQAL 424 + N+ D ++L IHPAST + ++EE+ ++ +M+RLSVGIED ED++ DL + L Sbjct: 349 RNATNLNDNKSLIIHPASTIFGEYSDEERHGMDISDNMLRLSVGIEDREDLLDDLQKGL 407 Lambda K H 0.317 0.136 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 426 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 430 Length of database: 410 Length adjustment: 32 Effective length of query: 398 Effective length of database: 378 Effective search space: 150444 Effective search space used: 150444 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory