Align threonine synthase (EC 4.2.3.1) (characterized)
to candidate WP_012504854.1 PAES_RS01285 threonine synthase
Query= BRENDA::P00934 (428 letters) >NCBI__GCF_000020625.1:WP_012504854.1 Length = 438 Score = 319 bits (818), Expect = 9e-92 Identities = 179/430 (41%), Positives = 255/430 (59%), Gaps = 10/430 (2%) Query: 1 MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDEMLKLDFVTRSAKILS 60 M Y+ + S +A +GL + GL+ P +P FS +EI+ + + F + I Sbjct: 1 MIYYSTNKSSTPASLKRATLEGLAPDGGLYVPSAIPVFSPSEIELLKEAPFKDIAFAIAK 60 Query: 61 AFIGDEIPQEILEERVRAAFAFPAPVANVESDVGCLELFHGPTLAFKDFGGRFMAQMLTH 120 + G EIP + L E + F FP P+ ++++ ELFHGPTLAFKD+G RF+A+M + Sbjct: 61 KYTGSEIPPDRLYEIIEECFNFPTPLVPLDNNTFIEELFHGPTLAFKDYGARFLARMTGY 120 Query: 121 IAGDKP--VTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIE 178 A + +TIL ATSGDTG+AVA+ F G+PN +VV+LYP GK+S LQE+ T GGN+ Sbjct: 121 FAEEDHTLITILVATSGDTGSAVAYGFQGIPNTRVVLLYPSGKVSRLQEQQLTTAGGNVT 180 Query: 179 TVAIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQICYYFEAVAQLPQE-T 237 + + GDFD CQ LVKQAF D +K L L SANSINISRL+ Q YY A QL ++ Sbjct: 181 ALEVKGDFDDCQRLVKQAFMDGSIKQNLTLTSANSINISRLIPQSFYYAWAALQLDRKYP 240 Query: 238 RNQLVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLHDGQWSPKATQATL 297 + V SVPSGN+G+LTAG+LAK +G P+ FIAA+N ND+V R++ +G++ P T TL Sbjct: 241 GKKAVFSVPSGNYGNLTAGVLAKMMGFPIDHFIAASNANDSVTRYIEEGRYEPHPTIRTL 300 Query: 298 SNAMDVSQPNNWPRVEELFRRKIWQLKE--LGYAAVDDETTQQTMRELKELGYTSEPHAA 355 S AMDV P+N+ R+ ++ ++ GY+ D+ET + GY +PH A Sbjct: 301 STAMDVGDPSNFARLRHIYANDHTKMAADITGYSISDNETLETIRSVYDRFGYIMDPHTA 360 Query: 356 VAYRAL---RDQLNPGEY--GLFLGTAHPAKFKESVEAILGETLDLPKELAERADLPLLS 410 V RAL R+Q+ + + L TAHPAKF ES+ L + +P L D ++ Sbjct: 361 VGSRALELWREQMTQADSNPAVVLSTAHPAKFLESIREALDMEISIPDRLQTVLDKQKIA 420 Query: 411 HNLPADFAAL 420 + +D+ L Sbjct: 421 TLIGSDYNEL 430 Lambda K H 0.319 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 426 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 428 Length of database: 438 Length adjustment: 32 Effective length of query: 396 Effective length of database: 406 Effective search space: 160776 Effective search space used: 160776 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate WP_012504854.1 PAES_RS01285 (threonine synthase)
to HMM TIGR00260 (thrC: threonine synthase (EC 4.2.3.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00260.hmm # target sequence database: /tmp/gapView.23236.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00260 [M=340] Accession: TIGR00260 Description: thrC: threonine synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.1e-89 284.1 0.0 1.1e-88 283.6 0.0 1.0 1 lcl|NCBI__GCF_000020625.1:WP_012504854.1 PAES_RS01285 threonine synthase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000020625.1:WP_012504854.1 PAES_RS01285 threonine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 283.6 0.0 1.1e-88 1.1e-88 13 329 .. 67 397 .. 58 405 .. 0.90 Alignments for each domain: == domain 1 score: 283.6 bits; conditional E-value: 1.1e-88 TIGR00260 13 kdlvdlaegstelfrspklaeevgaenlyvkelfhgPtlaFKDrglqfvavlltkalelgne..tvlcA 79 +++ l e e f++p++ ++ n ++ elfhgPtlaFKD g +f+a + +++e+ + t+l+A lcl|NCBI__GCF_000020625.1:WP_012504854.1 67 IPPDRLYEIIEECFNFPTPLVPLDN-NTFIEELFHGPTLAFKDYGARFLARMTGYFAEEDHTliTILVA 134 5666777888899**********99.********************************999989***** PP TIGR00260 80 tsGdtgaaaaealagkanvkvvvLyPkgkispvkeklvtalaenakvlaikGdFDdaqdlvkeife... 145 tsGdtg+a+a++++g +n +vv LyP+gk+s ++e+ +t+ +n++ l++kGdFDd+q+lvk++f lcl|NCBI__GCF_000020625.1:WP_012504854.1 135 TSGDTGSAVAYGFQGIPNTRVVLLYPSGKVSRLQEQQLTTAGGNVTALEVKGDFDDCQRLVKQAFMdgs 203 *********************************99999***************************9444 PP TIGR00260 146 dkeklklnsvNsinparieaqk.tyafeiveqlgkespdkvvvpvpsgnfgailkGflekkelglpiek 213 k++l l s+Nsin++r+ q +ya+ +++ k +k v++vpsgn g++++G + +k++g pi lcl|NCBI__GCF_000020625.1:WP_012504854.1 204 IKQNLTLTSANSINISRLIPQSfYYAWAALQLDRKYPGKKAVFSVPSGNYGNLTAG-VLAKMMGFPI-D 270 456*******************9*******99999999******************.6667777**5.5 PP TIGR00260 214 laiaaegaadivrrflksgdlepkedkeTlstAmdignpsnverale..larrslgnledlkesvsdee 280 +iaa +a+d v+r++++g ep+ + TlstAmd+g psn+ r+ + + +++ ++ ++s+sd+e lcl|NCBI__GCF_000020625.1:WP_012504854.1 271 HFIAASNANDSVTRYIEEGRYEPHPTIRTLSTAMDVGDPSNFARLRHiyANDHTKMAADITGYSISDNE 339 678888888**************************************6555566666677889****** PP TIGR00260 281 ileaikklaeeegyllephtavavaalkklvekg.vs........atadpaKFeevve 329 +le+i+ ++ + gy+++phtav+ +al+ e+ + +ta+paKF e++ lcl|NCBI__GCF_000020625.1:WP_012504854.1 340 TLETIRSVYDRFGYIMDPHTAVGSRALELWREQMtQAdsnpavvlSTAHPAKFLESIR 397 **************************9866555542233566678********98876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (340 nodes) Target sequences: 1 (438 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 8.93 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory