Align Valine--pyruvate aminotransferase; Alanine--valine transaminase; EC 2.6.1.66 (characterized)
to candidate WP_012506211.1 PAES_RS08295 aminotransferase class V-fold PLP-dependent enzyme
Query= SwissProt::P96847 (388 letters) >NCBI__GCF_000020625.1:WP_012506211.1 Length = 404 Score = 129 bits (323), Expect = 2e-34 Identities = 110/356 (30%), Positives = 155/356 (43%), Gaps = 21/356 (5%) Query: 46 PEPVRAAAAAALHLNQLGYSVALGIPELRDAIAADYQRRHGITVEPDAVVITTGSSGGFL 105 PE + A AL GYS + G E +AIA D RR GI+ PD V+IT G+S Sbjct: 55 PEELIEANVLALRHGHNGYSPSSGRKEAVEAIAEDACRR-GISTSPDNVIITFGASEAAD 113 Query: 106 LAFLACFDAGDRVAMASPGYPCYRNILSALGCEVVEIPCGPQTRFQPTAQMLAE-IDPPL 164 L + + GD V SPGYP Y I++ L V P + P + + + I P Sbjct: 114 LVCTSMLNPGDEVLCPSPGYPLYNAIIAKLNAREVRYSLDPANDWLPDPEQVEKSITPRT 173 Query: 165 RGVVVASPANPTGTVIPPEELAAIASWCDASDVRLISDEVYHGLVYQGAPQTSCAWQTSR 224 + +VV +P NPTG + E L + +I+DEVYH LVY+G + + Sbjct: 174 KILVVINPNNPTGELYSRETLDMFVDIARRHKLLIITDEVYHKLVYEGEHIPLASLASDD 233 Query: 225 NAVV-VNSFSKYYAMTGWRLGWL------LVPTVLRRAVDCLTGNFTICPPVLSQIAAVS 277 AV+ ++S SK Y GWR GWL L+P V R + +C P+ Q + Sbjct: 234 VAVITIDSLSKNYMAPGWRTGWLMITNSALIPDV--RQAFIKLADARLCAPMAPQYTIKA 291 Query: 278 AFT--PEATAEADGNLASYAINRSLLLDGLRRIGIDRLAPTDGAFYVYA----DVSDFTS 331 A T PE + L+ R L +D L I GAFYV D + F + Sbjct: 292 AMTMGPEYN---ETILSRLRAQRELTIDRLNAIEGFSCNKPSGAFYVMGKLDLDATPFKT 348 Query: 332 DSLAFCSKLLADTGVAIAPGIDFDTARGGSFVRISFAGPSGDIEEALRRIGSWLPS 387 D F KLL + V G F T + RI + +E+ + ++ S Sbjct: 349 DE-EFVLKLLQEKQVLFVHGSGFGTDPASGYARIVYLPDVTILEKVYADVADFINS 403 Lambda K H 0.321 0.136 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 375 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 404 Length adjustment: 31 Effective length of query: 357 Effective length of database: 373 Effective search space: 133161 Effective search space used: 133161 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory