Align threonine synthase (EC 4.2.3.1) (characterized)
to candidate WP_012536159.1 AFE_RS02240 threonine synthase
Query= BRENDA::P9WG59 (360 letters) >NCBI__GCF_000021485.1:WP_012536159.1 Length = 376 Score = 355 bits (910), Expect = e-102 Identities = 197/367 (53%), Positives = 244/367 (66%), Gaps = 26/367 (7%) Query: 12 WPGVIAAYRDRLPVGDDWTPVTLLEGGTPLIAATNLSKQTGCTIHL--KVEGLNPTGSFK 69 + G+I YR LP+ + V+L EG TPLI NL +Q G + L K EGLNPTGSFK Sbjct: 4 YTGIIDHYRAFLPLAPETPAVSLGEGNTPLIECINLPRQLGLDLRLFLKFEGLNPTGSFK 63 Query: 70 DRGMTMAVTDALAHGQRAVLCASTGNTSASAAAYAARAGITCAVLIPQGKIAMGKLAQAV 129 DRGM MAVT A G V+CASTGNTSA+AAAYAARAG+ V+IP+GKIA+GKL+QA+ Sbjct: 64 DRGMAMAVTKAKEDGSEMVICASTGNTSAAAAAYAARAGMRAFVVIPEGKIALGKLSQAM 123 Query: 130 MHGAKIIQIDGNFDDCLELARKMAADFPTISLVNSVNPVRIEGQKTAAFEIVDVLGTAPD 189 MHGA ++QI GNFD +++ +++AA+ P I+LVNSVNP R++GQKTAAFEI++ LG APD Sbjct: 124 MHGAMVLQIRGNFDAGMQIVQEVAANAP-ITLVNSVNPYRLQGQKTAAFEIIEALGEAPD 182 Query: 190 VHALPVGNAGNITAYWKGYTE-----------------------YHQLGLIDKLPRMLGT 226 HALPVGNAGNITA+W GY E + G K P+MLG Sbjct: 183 YHALPVGNAGNITAHWMGYCEATDGRTDKSQPLTASCKFCNGTCSYGHGKAGKRPKMLGF 242 Query: 227 QAAGAAPLVLGEPVSHPETIATAIRIGSPASWTSAVEAQQQSKGRFLAASDEEILAAYHL 286 QAAG+AP ++G V PETIATAIRIG P SW A Q +S G F + SD EIL A Sbjct: 243 QAAGSAPFIVGHYVKDPETIATAIRIGHPMSWDQAHRVQAESGGWFGSHSDAEILEAQRW 302 Query: 287 VARVEGVFVEPASAASIAGLLKAIDDGWVARGSTVVCTVTGNGLKDPDTALKDMPSVSPV 346 +A+ EGVF EPASA S+AG++ G + G+TVVCT+TG+GLKDPDTA+ V V Sbjct: 303 LAQYEGVFCEPASATSVAGVVAEARAGKIEAGATVVCTLTGHGLKDPDTAIAQGGEVLTV 362 Query: 347 PVDPVAV 353 AV Sbjct: 363 DASLEAV 369 Lambda K H 0.317 0.132 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 377 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 376 Length adjustment: 30 Effective length of query: 330 Effective length of database: 346 Effective search space: 114180 Effective search space used: 114180 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_012536159.1 AFE_RS02240 (threonine synthase)
to HMM TIGR00260 (thrC: threonine synthase (EC 4.2.3.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00260.hmm # target sequence database: /tmp/gapView.8256.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00260 [M=340] Accession: TIGR00260 Description: thrC: threonine synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-92 296.8 0.0 7.1e-92 294.1 0.0 1.9 1 lcl|NCBI__GCF_000021485.1:WP_012536159.1 AFE_RS02240 threonine synthase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000021485.1:WP_012536159.1 AFE_RS02240 threonine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 294.1 0.0 7.1e-92 7.1e-92 2 340 .] 9 350 .. 8 350 .. 0.98 Alignments for each domain: == domain 1 score: 294.1 bits; conditional E-value: 7.1e-92 TIGR00260 2 vryreilevt.ekdlvdlaegstelfrspklaeevga.enlyvkelfhgPtlaFKDrglqfvavlltka 68 yr++l+ e+++v+l eg+t+l+++ +l++++g+ +l++k ++++Pt++FKDrg +a+++tka lcl|NCBI__GCF_000021485.1:WP_012536159.1 9 DHYRAFLPLApETPAVSLGEGNTPLIECINLPRQLGLdLRLFLKFEGLNPTGSFKDRG---MAMAVTKA 74 579******99**************************99*******************...******** PP TIGR00260 69 lelgnetvlcAtsGdtgaaaaealagkanvkvvvLyPkgkispvkeklvtalaenakvlaikGdFDdaq 137 +e+g e+v+cA++G+t+aaaa a+a++a+++++v++P+gki+ +kl +a++++a vl+i+G+FD+ lcl|NCBI__GCF_000021485.1:WP_012536159.1 75 KEDGSEMVICASTGNTSAAAA-AYAARAGMRAFVVIPEGKIA--LGKLSQAMMHGAMVLQIRGNFDAGM 140 *********************.********************..************************* PP TIGR00260 138 dlvkeifedkeklklnsvNsinparieaqktyafeiveqlgkespdkvvvpvp.sgnfgailkGflekk 205 ++v+e++ + +++++nsvN p+r+++qkt+afei+e+lg e+pd ++pv+ +gn++a ++G++e+ lcl|NCBI__GCF_000021485.1:WP_012536159.1 141 QIVQEVAANAPITLVNSVN---PYRLQGQKTAAFEIIEALG-EAPDYHALPVGnAGNITAHWMGYCEAT 205 ************9999999...*******************.**************************9 PP TIGR00260 206 elg...........................lpieklaiaaegaadivrrflksgdlepkedkeTlstAm 247 + +p ++l+++a g+a+++ +d+eT++tA+ lcl|NCBI__GCF_000021485.1:WP_012536159.1 206 DGRtdksqpltasckfcngtcsyghgkagkRP-KMLGFQAAGSAPFIVGH-------YVKDPETIATAI 266 99899************************999.**********9987766.......6789******** PP TIGR00260 248 dignpsnveralelarrslgnledlkesvsdeeileaikklaeeegyllephtavavaalkklvekgvs 316 +ig+p ++++a ++ +s+g + + sd+eilea++ la+ eg+++ep++a++va++ + +g lcl|NCBI__GCF_000021485.1:WP_012536159.1 267 RIGHPMSWDQAHRVQAESGGWFGSH----SDAEILEAQRWLAQYEGVFCEPASATSVAGVVAEARAG-- 329 ************************9....************************************99.. PP TIGR00260 317 atadpaKFeevvealtgnklkdpe 340 +++ + ++vv+ ltg++lkdp+ lcl|NCBI__GCF_000021485.1:WP_012536159.1 330 -KIEAG--ATVVCTLTGHGLKDPD 350 .*****..**************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (340 nodes) Target sequences: 1 (376 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.03u 0.01s 00:00:00.04 Elapsed: 00:00:00.04 # Mc/sec: 3.15 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory