Align Chorismate synthase; CS; 5-enolpyruvylshikimate-3-phosphate phospholyase; EC 4.2.3.5 (characterized)
to candidate WP_012673988.1 SULAZ_RS05650 chorismate synthase
Query= SwissProt::O66493 (398 letters) >NCBI__GCF_000021545.1:WP_012673988.1 Length = 390 Score = 487 bits (1253), Expect = e-142 Identities = 254/397 (63%), Positives = 304/397 (76%), Gaps = 12/397 (3%) Query: 6 LRFLTAGESHGKGLTAILEGIPANLPLSEEEINHELRRRQRGYGRGGRMKIEKDTAEILS 65 LRFL AGESHG LTAI+EG P+N+ +S + INHEL RRQ+GYGRGGRMKIEKDT EILS Sbjct: 2 LRFLNAGESHGPALTAIVEGYPSNVNVSSDRINHELARRQKGYGRGGRMKIEKDTVEILS 61 Query: 66 GVRFGKTLGSPIALFIRNRDWENWKEKMAIEGEPSPSVVPFTRPRPGHADLSGGIKYNQR 125 GVRFG TLG+PI L I+N+DWENW + MA+EG+P PRPGHADL GGIKY Sbjct: 62 GVRFGITLGTPITLMIKNKDWENWTDIMAVEGQPIDKR-QILEPRPGHADLIGGIKYGFY 120 Query: 126 DLRNILERASARETAARVAVGAVCKKFLSEFGIKIGSFVVSIGQKEV--EELKDKSYFAN 183 DLRN+LERASARET RVAVGA+CK L + GIKIGS+V+SIG+K++ EE+K+ SY Sbjct: 121 DLRNVLERASARETTTRVAVGALCKILLEDIGIKIGSYVLSIGEKKIYKEEIKNLSYEER 180 Query: 184 PEKLLSYHEKAEDSELRIPFPEKDEEFKTYIDEVKEKGESLGGVFEVFALNVPPGLGSHI 243 E AE+SE+RIP KDEEFK YID++KE+GESLGGVFEV+ALNVP GLGS+ Sbjct: 181 -------FENAENSEVRIPVLGKDEEFKEYIDKMKEEGESLGGVFEVYALNVPIGLGSYS 233 Query: 244 QWDRRIDGRIAQAMMSIQAIKGVEIGLGFEAARRFGSQVHDEIGWSEGKGYFRHSNNLGG 303 QWDRR+DG IAQA+MSIQAIKGVEIG GF G HDEI WS+ +G++R +N GG Sbjct: 234 QWDRRLDGIIAQAIMSIQAIKGVEIGEGFNLTYTTGYNAHDEIFWSKEEGFYRKTNRAGG 293 Query: 304 TEGGITNGMPIVVRVAMKPIPTL--KNPLRSVDIETKEEMKAGKERTDIVAVPAASVVGE 361 EGG+TNGMPIVVR AMKPIPTL + L+SV+++TKE A KER+DI AVPAA+VV E Sbjct: 294 LEGGMTNGMPIVVRAAMKPIPTLMRQKSLKSVNVKTKEPFDAAKERSDITAVPAAAVVAE 353 Query: 362 AMLAIVLADALLEKLGGDFMEEVKKRFEDYVNHVKSF 398 +MLA VLA +L+K G D E+KKR EDY +VKS+ Sbjct: 354 SMLAFVLAREILQKFGKDNWIEIKKRIEDYREYVKSY 390 Lambda K H 0.317 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 545 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 398 Length of database: 390 Length adjustment: 31 Effective length of query: 367 Effective length of database: 359 Effective search space: 131753 Effective search space used: 131753 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_012673988.1 SULAZ_RS05650 (chorismate synthase)
to HMM TIGR00033 (aroC: chorismate synthase (EC 4.2.3.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00033.hmm # target sequence database: /tmp/gapView.2347.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00033 [M=351] Accession: TIGR00033 Description: aroC: chorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-127 410.5 0.1 3e-127 410.3 0.1 1.0 1 lcl|NCBI__GCF_000021545.1:WP_012673988.1 SULAZ_RS05650 chorismate synthas Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000021545.1:WP_012673988.1 SULAZ_RS05650 chorismate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 410.3 0.1 3e-127 3e-127 1 350 [. 2 370 .. 2 371 .. 0.96 Alignments for each domain: == domain 1 score: 410.3 bits; conditional E-value: 3e-127 TIGR00033 1 lrlttfGeSHgkalgaiidGlPaglelteediqkelkrRrpgqsrltrmrkEeDeveilsGvfeGkTtG 69 lr++ +GeSHg+al+ai++G P++++++ + i++el+rR++g++r+ rm+ E+D+veilsGv+ G T G lcl|NCBI__GCF_000021545.1:WP_012673988.1 2 LRFLNAGESHGPALTAIVEGYPSNVNVSSDRINHELARRQKGYGRGGRMKIEKDTVEILSGVRFGITLG 70 68999**************************************************************** PP TIGR00033 70 aPiallikNkd.........vrskdyed.ikelpRPgHadytylkKYgikd.regggrsSaReTaarva 127 +Pi+l+ikNkd v+++++++ pRPgHad+ + KYg++d r+ ++r+SaReT++rva lcl|NCBI__GCF_000021545.1:WP_012673988.1 71 TPITLMIKNKDwenwtdimaVEGQPIDKrQILEPRPGHADLIGGIKYGFYDlRNVLERASARETTTRVA 139 ******************999999999945568************************************ PP TIGR00033 128 aGavakklLketagieivayvvklgeveleeesak....eiskerldkspvrcpdaeaekemeeeidka 192 +Ga+ k lL++ gi+i +yv ++ge+++ +e++k e+ e++++s+vr+p +++e +e+idk+ lcl|NCBI__GCF_000021545.1:WP_012673988.1 140 VGALCKILLED-IGIKIGSYVLSIGEKKIYKEEIKnlsyEERFENAENSEVRIPVLGKDEEFKEYIDKM 207 **********9.88**************99999997766556667777********************* PP TIGR00033 193 kkdgdsvGgvvevvvsnvpvglG..eplfdkldaelasallsinAvKgveiGdGFeaasvrGseanDel 259 k++g+s+Ggv ev + nvp glG ++++++ld+ +a+a++si+A+KgveiG+GF++++++G +a+De+ lcl|NCBI__GCF_000021545.1:WP_012673988.1 208 KEEGESLGGVFEVYALNVPIGLGsySQWDRRLDGIIAQAIMSIQAIKGVEIGEGFNLTYTTGYNAHDEI 276 ***********************999******************************************* PP TIGR00033 260 vle.ddkirrktnnsGGieGGitnGedirvriavKpiptik..kplktvdletkekakatkgRhDpcvv 325 ++ ++++ rktn+ GG+eGG+tnG++i+vr+a+Kpipt+ k lk+v+++tke+ a+k+R+D ++v lcl|NCBI__GCF_000021545.1:WP_012673988.1 277 FWSkEEGFYRKTNRAGGLEGGMTNGMPIVVRAAMKPIPTLMrqKSLKSVNVKTKEPFDAAKERSDITAV 345 **9999*********************************96225689********************** PP TIGR00033 326 pravpvvEamvalvladallekras 350 p+a++v+E+m+a+vla ++l+k+++ lcl|NCBI__GCF_000021545.1:WP_012673988.1 346 PAAAVVAESMLAFVLAREILQKFGK 370 *********************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (390 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.93 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory