Align threonine synthase (EC 4.2.3.1) (characterized)
to candidate WP_012676942.1 PERMA_RS01265 threonine synthase
Query= BRENDA::O66740 (352 letters) >NCBI__GCF_000021565.1:WP_012676942.1 Length = 356 Score = 553 bits (1426), Expect = e-162 Identities = 268/351 (76%), Positives = 310/351 (88%), Gaps = 2/351 (0%) Query: 3 RWQGIIKQYKKYLPVDENTPIVTLYEGNTPLIEADNLARAIGFKG--KIYLKYEGLNPTG 60 +W+GII Y+++LPV + TP+VTLYEGNTPLI+A NL++ I KIYLKYEGLNPTG Sbjct: 5 KWRGIITAYREFLPVTDKTPVVTLYEGNTPLIDAPNLSKKIAPDKDLKIYLKYEGLNPTG 64 Query: 61 SFKDRGMTLAISKAVEAGKRAVICASTGNTSASAAAYAARAGLRAYVLLPKGAVAIGKLS 120 SFKDRGMT+AISKA E+GK AVICASTGNTSASAAAYAARAG+ AYV+LPKGAVA+GKLS Sbjct: 65 SFKDRGMTMAISKAKESGKTAVICASTGNTSASAAAYAARAGMDAYVILPKGAVALGKLS 124 Query: 121 QAMIYGAKVLAIQGTFDDALNIVRKIGENFPVEIVNSVNPYRIEGQKTAAFEICDTLGEA 180 QAM+YGAK++A+ G FDDAL+IVR+IGE +PVE+VNSVNPYRIEGQKTA+FEI D LG+A Sbjct: 125 QAMVYGAKIIALMGNFDDALSIVREIGEKYPVEVVNSVNPYRIEGQKTASFEIIDALGDA 184 Query: 181 PDYHFIPVGNAGNITAYWKGFKIYYEEGKITKLPRMMGWQAEGAAPIVKGYPIKNPQTIA 240 PDYHFIPVGNAGNITAYWKG+K Y E G+ TKLPRM+GWQAEGAAPIVKG+PIKNPQTIA Sbjct: 185 PDYHFIPVGNAGNITAYWKGYKEYKEAGRSTKLPRMIGWQAEGAAPIVKGFPIKNPQTIA 244 Query: 241 TAIKIGNPYSWKSALKAAQESGGKIDAVSDSEILYAYKLIASTEGVFCEPASAASVAGLI 300 TAIKIGNPYSW+ AL+AA+ES G IDAVSD EIL AY+L+ASTEGVFCEPASAASVAG+I Sbjct: 245 TAIKIGNPYSWQPALQAAKESNGFIDAVSDEEILEAYRLVASTEGVFCEPASAASVAGVI 304 Query: 301 KLVREGFFKGGEVVTCTLTGNGLKDPDTAIKVCEEPITVPPDFDEVVKVLG 351 K R+G FKGGE V CTLTGNGLKDPDT IK E+P+ +PPD +E+ + LG Sbjct: 305 KAYRKGLFKGGETVVCTLTGNGLKDPDTVIKASEKPVEMPPDINEIARYLG 355 Lambda K H 0.317 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 572 Number of extensions: 22 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 352 Length of database: 356 Length adjustment: 29 Effective length of query: 323 Effective length of database: 327 Effective search space: 105621 Effective search space used: 105621 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_012676942.1 PERMA_RS01265 (threonine synthase)
to HMM TIGR00260 (thrC: threonine synthase (EC 4.2.3.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00260.hmm # target sequence database: /tmp/gapView.28871.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00260 [M=340] Accession: TIGR00260 Description: thrC: threonine synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-106 342.1 0.0 2e-106 341.9 0.0 1.0 1 lcl|NCBI__GCF_000021565.1:WP_012676942.1 PERMA_RS01265 threonine synthase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000021565.1:WP_012676942.1 PERMA_RS01265 threonine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 341.9 0.0 2e-106 2e-106 1 340 [] 10 331 .. 10 331 .. 0.98 Alignments for each domain: == domain 1 score: 341.9 bits; conditional E-value: 2e-106 TIGR00260 1 vvryreilevt.ekdlvdlaegstelfrspklaeevga...enlyvkelfhgPtlaFKDrglqfvavll 65 ++ yre+l+vt ++++v+l eg+t+l+++p+l++++ ++y+k ++++Pt++FKDrg +++++ lcl|NCBI__GCF_000021565.1:WP_012676942.1 10 ITAYREFLPVTdKTPVVTLYEGNTPLIDAPNLSKKIAPdkdLKIYLKYEGLNPTGSFKDRG---MTMAI 75 678********99***********************98856678*****************...***** PP TIGR00260 66 tkalelgnetvlcAtsGdtgaaaaealagkanvkvvvLyPkgkispvkeklvtalaenakvlaikGdFD 134 +ka+e g+++v+cA++G+t+a+aa a+a++a+++++v++Pkg ++ +kl +a++++ak++a G+FD lcl|NCBI__GCF_000021565.1:WP_012676942.1 76 SKAKESGKTAVICASTGNTSASAA-AYAARAGMDAYVILPKGAVA--LGKLSQAMVYGAKIIALMGNFD 141 ************************.********************..********************** PP TIGR00260 135 daqdlvkeifedkeklklnsvNsinparieaqktyafeiveqlgkespdkvvvpvp.sgnfgailkGfl 202 da+ +v+ei ek+ + +vNs+np+rie+qkt+ fei+++lg ++pd +pv+ +gn++a++kG++ lcl|NCBI__GCF_000021565.1:WP_012676942.1 142 DALSIVREIG---EKYPVEVVNSVNPYRIEGQKTASFEIIDALG-DAPDYHFIPVGnAGNITAYWKGYK 206 *********9...677889999999*******************.************************ PP TIGR00260 203 ekkelg....lpieklaiaaegaadivrrflksgdlepkedkeTlstAmdignpsnveralelarrslg 267 e+ke+g lp ++++ +aegaa+iv+ f p+++++T++tA++ignp +++ al++a++s+g lcl|NCBI__GCF_000021565.1:WP_012676942.1 207 EYKEAGrstkLP-RMIGWQAEGAAPIVKGF-------PIKNPQTIATAIKIGNPYSWQPALQAAKESNG 267 ************.*****************.......******************************** PP TIGR00260 268 nledlkesvsdeeileaikklaeeegyllephtavavaalkklvekgvsatadpaKFeevvealtgnkl 336 ++++ sdeeilea++++a +eg+++ep++a++va+++k kg + + e+vv+ ltgn+l lcl|NCBI__GCF_000021565.1:WP_012676942.1 268 FIDAV----SDEEILEAYRLVASTEGVFCEPASAASVAGVIKAYRKG---LFKGG--ETVVCTLTGNGL 327 *****....**************************************...88888..************ PP TIGR00260 337 kdpe 340 kdp+ lcl|NCBI__GCF_000021565.1:WP_012676942.1 328 KDPD 331 **97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (340 nodes) Target sequences: 1 (356 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.89 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory