Align Putative branched-chain-amino-acid aminotransferase; BCAT; EC 2.6.1.42; Transaminase B (uncharacterized)
to candidate WP_012676469.1 PERMA_RS08100 aminodeoxychorismate lyase (4-amino-4-deoxychorismatelyase) (adc lyase) (adcl)
Query= curated2:O29329 (290 letters) >NCBI__GCF_000021565.1:WP_012676469.1 Length = 249 Score = 92.4 bits (228), Expect = 9e-24 Identities = 81/242 (33%), Positives = 123/242 (50%), Gaps = 16/242 (6%) Query: 21 FDHGFLYGDGVFEGIRAYNGRVFR-LKEHIDRLYDSAKAIDLEIP-ITKEEFMEIILETL 78 F +YG+GVFE R Y GR+ + + +H RL A+ L+IP ITKE+++ I ET+ Sbjct: 17 FLRSVMYGEGVFETFR-YRGRLPKHIDQHYRRLIKGAEL--LKIPKITKEDYIFYIEETV 73 Query: 79 RK-NNLRDAYIRPIV-TRGIGDLGLDPRKCQNPSIIVITKPWGKLYGDLYEKGLTAITVA 136 +K D Y++ ++ + G + P K ++VI KP Y + +K ++ Sbjct: 74 KKCKESDDLYVKTVLLSEGNIYFPVVPYKSH---LLVIVKP----YKEPEKKEISLAVAP 126 Query: 137 VRRNSFDALPPNIKSLNYLNNILAKIEANAKGGDEAIFLDRNGYVSEGSGDNIFVVKNGA 196 R +S D + IKS NY NI+AK A KG D+A+FL+ NG V+E S NIF +K Sbjct: 127 FRVHSSDPML-KIKSTNYSRNIIAKRYALEKGYDDALFLNENGEVTETSSANIFWIKGRF 185 Query: 197 ITTPPT-INNLRGITREAVIEIINRLGIPFKETNIGLYDLYTADEVFVTGTAAEIAPIVV 255 + TP L G+TR +++ G E L D+ AD +FV I + Sbjct: 186 LYTPSVDCGLLPGVTRSVILKKAKDEGFAVVEGRFYLEDVRKADYIFVANALNGIIRVSK 245 Query: 256 ID 257 I+ Sbjct: 246 IE 247 Lambda K H 0.319 0.142 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 187 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 290 Length of database: 249 Length adjustment: 25 Effective length of query: 265 Effective length of database: 224 Effective search space: 59360 Effective search space used: 59360 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory