Align branched-chain-amino-acid transaminase (EC 2.6.1.42) (characterized)
to candidate WP_015898939.1 PERMA_RS06100 branched-chain amino acid transaminase
Query= BRENDA::F0QW25 (314 letters) >NCBI__GCF_000021565.1:WP_015898939.1 Length = 302 Score = 305 bits (780), Expect = 1e-87 Identities = 142/301 (47%), Positives = 215/301 (71%), Gaps = 1/301 (0%) Query: 14 MKYVWVNGKLIPEKEATIPILTHALHYGTSIFEGIRAYWNSDNNNLYVFRARDHYVRFHD 73 M+Y++ GK++PE +A I I T++ HYGT+IFEGIRAY++ D + ++ ++HY R Sbjct: 1 MEYIYFEGKIVPEDQAKISIKTNSFHYGTAIFEGIRAYYDKDTDRMWGLFFKEHYERLFQ 60 Query: 74 SAKIMSIKVGYSVDELIDATVELLRANDVHEDVYIRPITFVSASTVNLDIRNLDVTTAII 133 + K++++++ S+D+L++ T EL+R N++ +D+YIRPI + S ++ + AI Sbjct: 61 NMKVLNMEIEESIDQLVEITKELIRKNNIKDDIYIRPIVYFSDLKISPKLVGYKSRIAIY 120 Query: 134 TVPFGHYLE-PKGIKAKVVSWLRVHNSMFPMKAKVSGIYVNSVIAIIDAKVSGFDEAILL 192 T P G Y++ KGIKA V SW R++++M P + KV+G YVNS + +A ++G DEAI+L Sbjct: 121 TYPLGDYIDINKGIKAIVSSWTRINDNMIPPRLKVAGSYVNSAFSKTEAILAGADEAIVL 180 Query: 193 NRDGYVAEGSGENIFIIKDGILYTPPVYDSILEGITRDTVITIARDLGLTVTEKRITREE 252 N++GYV+EGS ENIFI++DG L TPPV D ILEGITR+ +ITIA+DLG V E+ I+R E Sbjct: 181 NKNGYVSEGSAENIFIVRDGKLITPPVSDDILEGITRNAIITIAKDLGYQVIERHISRTE 240 Query: 253 LYTADEVFFTGTAAEVTPVVNIDGRVIGNGEPGPIALKVRSYYMDVVHGRVSKYKNWLTP 312 LY ADE+FF GT A+V+PVV +D R IG+G PG I +++ Y + V G++ KY++W+ P Sbjct: 241 LYIADEIFFCGTGAQVSPVVEVDHRKIGDGSPGKITKEIQEVYFNAVRGKIEKYRHWVIP 300 Query: 313 I 313 I Sbjct: 301 I 301 Lambda K H 0.321 0.139 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 331 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 302 Length adjustment: 27 Effective length of query: 287 Effective length of database: 275 Effective search space: 78925 Effective search space used: 78925 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_015898939.1 PERMA_RS06100 (branched-chain amino acid transaminase)
to HMM TIGR01122 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01122.hmm # target sequence database: /tmp/gapView.25084.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01122 [M=298] Accession: TIGR01122 Description: ilvE_I: branched-chain amino acid aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-117 378.0 1.1 1.7e-117 377.8 1.1 1.0 1 lcl|NCBI__GCF_000021565.1:WP_015898939.1 PERMA_RS06100 branched-chain ami Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000021565.1:WP_015898939.1 PERMA_RS06100 branched-chain amino acid transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 377.8 1.1 1.7e-117 1.7e-117 1 296 [. 5 299 .. 5 301 .. 0.97 Alignments for each domain: == domain 1 score: 377.8 bits; conditional E-value: 1.7e-117 TIGR01122 1 wldGelvdvedakvhvlthalhYGtgvfeGiRaYetdkglai..frlkehveRlydsakilrleipysk 67 +++G++v++++ak+++ t+++hYGt++feGiRaY ++ ++ +++keh+eRl+++ k+l++ei+ s lcl|NCBI__GCF_000021565.1:WP_015898939.1 5 YFEGKIVPEDQAKISIKTNSFHYGTAIFEGIRAYYDKDTDRMwgLFFKEHYERLFQNMKVLNMEIEESI 73 89*******************************98777555423789********************** PP TIGR01122 68 eelvevtkevlrknnlks.aYiRplvyvGaedlglkpk.vdlkveviiaawewgaylgeealekGikvk 134 ++lve+tke++rknn+k+ YiRp+vy + dl+++pk v++k +++i+++++g y++ ++kGik++ lcl|NCBI__GCF_000021565.1:WP_015898939.1 74 DQLVEITKELIRKNNIKDdIYIRPIVY--FSDLKISPKlVGYKSRIAIYTYPLGDYID---INKGIKAI 137 *****************99********..99***************************...79****** PP TIGR01122 135 vssfrraavnsiptkakaagnYlnsllaksealraGydeailLdeeGyvaeGsGenifivkdgvlltPp 203 vss++r ++n+ip+++k+ag+Y+ns++ k+ea+ aG+deai+L+++Gyv+eGs enifiv+dg+l+tPp lcl|NCBI__GCF_000021565.1:WP_015898939.1 138 VSSWTRINDNMIPPRLKVAGSYVNSAFSKTEAILAGADEAIVLNKNGYVSEGSAENIFIVRDGKLITPP 206 ********************************************************************* PP TIGR01122 204 vsesiLkgitrdaviklakelgievkeerisreelytaDevfltGtaaevtPirevDgrkigegkrGpv 272 vs+ iL+gitr+a+i++ak+lg++v e++isr+ely+aDe+f+ Gt a v P++evD+rkig+g+ G++ lcl|NCBI__GCF_000021565.1:WP_015898939.1 207 VSDDILEGITRNAIITIAKDLGYQVIERHISRTELYIADEIFFCGTGAQVSPVVEVDHRKIGDGSPGKI 275 ********************************************************************* PP TIGR01122 273 tkklqeaffdlvegktekkeewlt 296 tk++qe +f+ v+gk+ek+ +w+ lcl|NCBI__GCF_000021565.1:WP_015898939.1 276 TKEIQEVYFNAVRGKIEKYRHWVI 299 **********************86 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (302 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.78 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory