Align D-3-phosphoglycerate dehydrogenase; PGDH; EC 1.1.1.95; 2-oxoglutarate reductase; EC 1.1.1.399 (uncharacterized)
to candidate WP_012591482.1 MSIL_RS12680 D-glycerate dehydrogenase
Query= curated2:O33116 (528 letters) >NCBI__GCF_000021745.1:WP_012591482.1 Length = 331 Score = 171 bits (434), Expect = 3e-47 Identities = 116/322 (36%), Positives = 171/322 (53%), Gaps = 14/322 (4%) Query: 4 PVVLIADKL---AQSTVAALGDQVEVRWVDGP-DRTKLLAAVPEADALLVRSATTVDAEV 59 P+V++ KL ++ + L D ++ D P R++L AA+ AD L+ +DAE+ Sbjct: 6 PLVIVTRKLPDVVETRMCELFD-AKLNIDDKPMSRSELAAAMAAADVLVPTVTDRIDAEL 64 Query: 60 L-AAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLAASRQIA 118 + A ++K++A G G+DN+DV A RG+ V N P A+ +AL+LA +R+I Sbjct: 65 IRVAGEQMKLIANFGNGVDNIDVGIAAERGITVTNTPGVLTEDTADMTMALILAVARRIV 124 Query: 119 EADASLRAHIWKRSS---FSGTEIFGKTVGVVGLGRIGQLVAARIAAFGAHVIAYDP-YV 174 E S+ W S G I GK +G+VG+GRIGQ +A R AFG + ++ +V Sbjct: 125 EGAKSIPDGAWSGWSPTWMLGRRITGKRLGIVGMGRIGQALARRAKAFGLQIHYHNRRHV 184 Query: 175 APARAAQLGIELM-SFDDLLARADFISVHLPKTPETAGLIDKEALAKTKPGVIIVNAARG 233 A A QL S D +LAR D +SV+ P TP T L+ L +P I+VN ARG Sbjct: 185 AAAIEEQLEATYWESLDQMLARMDVVSVNCPHTPATYHLLSARRLKYLRPHAILVNTARG 244 Query: 234 GLVDEVALADAVRSGHVRAAGLDVFATEPCTDSPLFELSQ---VVVTPHLGASTAEAQDR 290 ++DE AL + G + AGLDVF EP L L++ V + PH+G++T E + Sbjct: 245 EIIDEAALTRMLELGELGGAGLDVFEHEPAVSKKLLRLAEAGKVTLLPHMGSATTEGRID 304 Query: 291 AGTDVAESVRLALAGEFVPDAV 312 G V +V+ L G PD V Sbjct: 305 MGEKVIVNVKTFLDGHRPPDRV 326 Lambda K H 0.317 0.132 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 348 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 528 Length of database: 331 Length adjustment: 32 Effective length of query: 496 Effective length of database: 299 Effective search space: 148304 Effective search space used: 148304 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory