Align Putative branched-chain-amino-acid aminotransferase; BCAT; EC 2.6.1.42; Transaminase B (uncharacterized)
to candidate WP_012589576.1 MSIL_RS02715 D-amino-acid transaminase
Query= curated2:O29329 (290 letters) >NCBI__GCF_000021745.1:WP_012589576.1 Length = 286 Score = 148 bits (374), Expect = 1e-40 Identities = 96/278 (34%), Positives = 146/278 (52%), Gaps = 10/278 (3%) Query: 5 YMDGEFVPENEAKVSIFDHGFLYGDGVFEGIRAYNGRVFRLKEHIDRLYDSAKAIDLEIP 64 Y++G +V +A VS+ D G+ +GDGV+E Y+G + H+DRL S K + +E P Sbjct: 6 YVNGAYVASRDAVVSVEDRGYQFGDGVYEVCEVYDGALIDEARHLDRLGRSLKELRIEAP 65 Query: 65 ITKEEFMEIILETLRKNNLRDAYIRPIVTRGIGDLG-LDPRKCQNPSIIVITKPWGKLYG 123 + I+ E +N L D Y+ VTRG+ + P S++V K G Sbjct: 66 VNPGALKVILREIRARNRLSDGYLYIQVTRGVAKRDHVFPDPPVRASLVVSAKAIAPEKG 125 Query: 124 D-LYEKGLTAITVA-VRRNSFDALPPNIKSLNYLNNILAKIEANAKGGDEAIFLDRNGYV 181 + KG+ T+ +R D IKS+ L N+LA+ +A +G EA +D +G + Sbjct: 126 EAAARKGVGVATMPDLRWKRVD-----IKSIGLLANVLARQDAKEQGAYEAWLVDSDGMI 180 Query: 182 SEGSGDNIFVV-KNGAITTPPTINN-LRGITREAVIEIINRLGIPFKETNIGLYDLYTAD 239 SEG+ N ++V ++GAI T ++ LRG+TR + +II G+ +E L + A Sbjct: 181 SEGAASNAWIVDQSGAIVTRQLDHSILRGVTRTTLFDIIAAEGLRLEERKFSLKEALAAQ 240 Query: 240 EVFVTGTAAEIAPIVVIDGRKIGDGKPGEITRKLMEEF 277 E F+TG + P+V IDG KIGDG PG + RKL F Sbjct: 241 EAFITGATTLVMPVVAIDGVKIGDGAPGPLARKLRALF 278 Lambda K H 0.319 0.142 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 239 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 290 Length of database: 286 Length adjustment: 26 Effective length of query: 264 Effective length of database: 260 Effective search space: 68640 Effective search space used: 68640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory