Align Chorismate synthase; CS; 5-enolpyruvylshikimate-3-phosphate phospholyase; EC 4.2.3.5 (characterized)
to candidate WP_015944646.1 DHAF_RS17635 chorismate synthase
Query= SwissProt::O66493 (398 letters) >NCBI__GCF_000021925.1:WP_015944646.1 Length = 382 Score = 375 bits (964), Expect = e-109 Identities = 190/390 (48%), Positives = 265/390 (67%), Gaps = 11/390 (2%) Query: 6 LRFLTAGESHGKGLTAILEGIPANLPLSEEEINHELRRRQRGYGRGGRMKIEKDTAEILS 65 +R+LTAGESHG L ILEG+P+ + +E I+ L+ RQ+G GRGGRMKIEKD ILS Sbjct: 1 MRYLTAGESHGPKLVGILEGVPSGAKIDKETIDQALQERQKGPGRGGRMKIEKDQITILS 60 Query: 66 GVRFGKTLGSPIALFIRNRDWENWKEKMAIEGEPSPSVVPFTRPRPGHADLSGGIKYNQR 125 GVR G T G+PIAL I NRDW NW++ MA E PRPGHADL+G +KY + Sbjct: 61 GVRGGLTTGAPIALEIINRDWANWEKIMAWGDEADLESRKVMTPRPGHADLTGYLKY-RT 119 Query: 126 DLRNILERASARETAARVAVGAVCKKFLSEFGIKIGSFVVSIGQKEVEELKDKSYFANPE 185 ++RN+LERASARETA RVA+G + + L G++I V+S+G+ ++ E Sbjct: 120 EVRNVLERASARETAMRVAIGNIAVQILEALGVEIRGQVLSVGKVHMDS----------E 169 Query: 186 KLLSYHEKAEDSELRIPFPEKDEEFKTYIDEVKEKGESLGGVFEVFALNVPPGLGSHIQW 245 Y ++ + SE ++ P+ +E + E + +GESLGGV ++ N+ PGLGS++QW Sbjct: 170 DTPEYWQRVQASEWKVGDPKGEEALDAQLQEARSQGESLGGVLQIQVRNLLPGLGSYVQW 229 Query: 246 DRRIDGRIAQAMMSIQAIKGVEIGLGFEAARRFGSQVHDEIGWSEGKGYFRHSNNLGGTE 305 DR++DGR+AQA++S+QAIKGV G+GF A + FGS+VHD IG+ G+GY+R+SNN GG E Sbjct: 230 DRKLDGRLAQAVLSVQAIKGVAFGMGFTAGQHFGSEVHDPIGYDSGRGYYRYSNNAGGIE 289 Query: 306 GGITNGMPIVVRVAMKPIPTLKNPLRSVDIETKEEMKAGKERTDIVAVPAASVVGEAMLA 365 GG+TNG P+++ MKPIPTL +PL +V++ETKE M+A ER+D+ AVPAA VV + + A Sbjct: 290 GGMTNGEPVIIEAVMKPIPTLYSPLSTVNLETKEVMEASVERSDVCAVPAALVVLKHVAA 349 Query: 366 IVLADALLEKLGGDFMEEVKKRFEDYVNHV 395 + A+LEK D +E+ K ++DY V Sbjct: 350 WEILQAILEKFPADTWDELDKAWQDYKRFV 379 Lambda K H 0.317 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 469 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 398 Length of database: 382 Length adjustment: 30 Effective length of query: 368 Effective length of database: 352 Effective search space: 129536 Effective search space used: 129536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_015944646.1 DHAF_RS17635 (chorismate synthase)
to HMM TIGR00033 (aroC: chorismate synthase (EC 4.2.3.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00033.hmm # target sequence database: /tmp/gapView.10978.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00033 [M=351] Accession: TIGR00033 Description: aroC: chorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-113 364.8 0.0 2.4e-113 364.6 0.0 1.0 1 lcl|NCBI__GCF_000021925.1:WP_015944646.1 DHAF_RS17635 chorismate synthase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000021925.1:WP_015944646.1 DHAF_RS17635 chorismate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 364.6 0.0 2.4e-113 2.4e-113 1 348 [. 1 360 [. 1 363 [. 0.96 Alignments for each domain: == domain 1 score: 364.6 bits; conditional E-value: 2.4e-113 TIGR00033 1 lrlttfGeSHgkalgaiidGlPaglelteediqkelkrRrpgqsrltrmrkEeDeveilsGvfeGkTtG 69 +r++t+GeSHg++l+ i++G+P+g ++++e+i ++l+ R++g +r+ rm+ E+D+++ilsGv+ G TtG lcl|NCBI__GCF_000021925.1:WP_015944646.1 1 MRYLTAGESHGPKLVGILEGVPSGAKIDKETIDQALQERQKGPGRGGRMKIEKDQITILSGVRGGLTTG 69 89******************************************************************* PP TIGR00033 70 aPiallikNkd...........vrskdyed.ikelpRPgHadytylkKYgikdregggrsSaReTaarv 126 aPial i N+d +d+e+ + +pRPgHad+t+ KY+++ r+ ++r+SaReTa+rv lcl|NCBI__GCF_000021925.1:WP_015944646.1 70 APIALEIINRDwanwekimawgD-EADLESrKVMTPRPGHADLTGYLKYRTEVRNVLERASARETAMRV 137 ***********999998866633.33333337789********************************** PP TIGR00033 127 aaGavakklLketagieivayvvklgeveleeesakeiskerldkspvrcpdaeaekemeeeidkakkd 195 a G +a + L+ g+ei + v ++g+v++++e + e +r+++s+ ++ d++ e+++ +++++a+++ lcl|NCBI__GCF_000021925.1:WP_015944646.1 138 AIGNIAVQILEA-LGVEIRGQVLSVGKVHMDSEDTPE-YWQRVQASEWKVGDPKGEEALDAQLQEARSQ 204 ***********9.88****************999987.7899999************************ PP TIGR00033 196 gdsvGgvvevvvsnvpvglG..eplfdkldaelasallsinAvKgveiGdGFeaasvrGseanDelvle 262 g+s+Ggv++++v+n+ glG +++++kld++la+a+ls++A+Kgv +G GF+a + Gse++D++ ++ lcl|NCBI__GCF_000021925.1:WP_015944646.1 205 GESLGGVLQIQVRNLLPGLGsyVQWDRKLDGRLAQAVLSVQAIKGVAFGMGFTAGQHFGSEVHDPIGYD 273 ********************999*********************************************9 PP TIGR00033 263 .ddkirrktnnsGGieGGitnGedirvriavKpiptikkplktvdletkekakatkgRhDpcvvpravp 330 ++ r +nn GGieGG+tnGe++ +++++Kpipt++ pl tv+letke ++a+++R+D+c+vp+a + lcl|NCBI__GCF_000021925.1:WP_015944646.1 274 sGRGYYRYSNNAGGIEGGMTNGEPVIIEAVMKPIPTLYSPLSTVNLETKEVMEASVERSDVCAVPAALV 342 8889***************************************************************** PP TIGR00033 331 vvEamvalvladallekr 348 v + a +++a+lek+ lcl|NCBI__GCF_000021925.1:WP_015944646.1 343 VLKHVAAWEILQAILEKF 360 ***************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (382 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 12.60 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory