Align Shikimate kinase; Short=SK; EC 2.7.1.71 (characterized, see rationale)
to candidate WP_015927836.1 MNOD_RS05470 shikimate kinase
Query= uniprot:AROK_RHIME (192 letters) >NCBI__GCF_000022085.1:WP_015927836.1 Length = 200 Score = 194 bits (493), Expect = 9e-55 Identities = 94/183 (51%), Positives = 130/183 (71%) Query: 7 PVSATLAERAKRTLGKRNLVFIGLMGAGKSAIGRLTAQALGVPFVDSDHEIERVSRMTVS 66 P T+ R +R LG+R++V +GLMGAGKS +GR A LG+ F+D+DHEIE + +T++ Sbjct: 6 PPDETIEARVRRGLGQRSIVLVGLMGAGKSTVGRRLAGRLGMIFMDADHEIEAAAGLTIA 65 Query: 67 DLFATYGEEEFRALEARVLKRLLRSGPRVVSTGGGAYINERSRRHIKKGGLTIWLNAELD 126 D+FA YGE FR E RV+ RLLR GP V++TGGGA++ +RR I + G+++WL AELD Sbjct: 66 DIFAIYGETSFRDGEERVIARLLRDGPMVLATGGGAFMRPETRRRIAERGVSVWLKAELD 125 Query: 127 VLWERVNKRDTRPLLKTENPKQTLENLMRARYPIYAEADLTVLSRDVKKEAMVEEVLAAV 186 VL RV KR RPLL+ E+P+ T+ LM R+P+Y ADL VLSRDV + +V++VL A+ Sbjct: 126 VLMRRVRKRPGRPLLQNEDPEGTMRRLMDVRHPVYGSADLMVLSRDVSHDRVVQDVLEAL 185 Query: 187 ADH 189 H Sbjct: 186 DTH 188 Lambda K H 0.317 0.133 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 114 Number of extensions: 1 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 192 Length of database: 200 Length adjustment: 20 Effective length of query: 172 Effective length of database: 180 Effective search space: 30960 Effective search space used: 30960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory