Align phosphoglycerate dehydrogenase (EC 1.1.1.95) (characterized)
to candidate WP_015927131.1 MNOD_RS01855 D-glycerate dehydrogenase
Query= BRENDA::P9WNX3 (528 letters) >NCBI__GCF_000022085.1:WP_015927131.1 Length = 334 Score = 176 bits (445), Expect = 2e-48 Identities = 110/286 (38%), Positives = 161/286 (56%), Gaps = 10/286 (3%) Query: 37 LLAAVPEADALLVRSATTVDAEVLA-AAPKLKIVARAGVGLDNVDVDAATARGVLVVNAP 95 L+ AV EAD L+ +DA +LA A P+L+++A G G+D++DVD+A RG+ V N P Sbjct: 44 LVQAVQEADVLVPTLTDEIDASLLAQAGPQLRLIANFGNGVDHIDVDSALQRGITVTNTP 103 Query: 96 TSNIHSAAEHALALLLAASRQIPAADASLREHTWKR----SSFSGTEIFGKTVGVVGLGR 151 A+ +AL+LA +R+I + E +W + G I GK +G+VG+GR Sbjct: 104 GVLTEDTADMTMALILAVARRITEGARIIPEESWTTGWSPTWMLGRRITGKRLGIVGMGR 163 Query: 152 IGQLVAQRIAAFGAYVVAYDPY-VSPARAAQLGIELL-SLDDLLARADFISVHLPKTPET 209 IGQ +A+R AFG + ++ VS A+L SLD +LAR D +SV+ P TP T Sbjct: 164 IGQALARRARAFGLSIHYHNRRRVSARTEAELEATYWESLDQMLARVDIVSVNCPHTPAT 223 Query: 210 AGLIDKEALAKTKPGVIIVNAARGGLVDEAALADAITGGHVRAAGLDVFATEPCTDSPLF 269 L+ L KP ++VN ARG ++DE ALA I G + AGLDVF EP L Sbjct: 224 YHLLSARRLKLLKPEAVVVNTARGEVIDETALARLIEVGDIAGAGLDVFEQEPAVSPRLV 283 Query: 270 ELA---QVVVTPHLGASTAEAQDRAGTDVAESVRLALAGEFVPDAV 312 +LA +VV+ PH+G++T E++ G V +++ + G PD V Sbjct: 284 KLAKAGKVVLLPHMGSATHESRIDMGEKVIINIKTFMDGHRPPDRV 329 Lambda K H 0.317 0.133 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 344 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 528 Length of database: 334 Length adjustment: 32 Effective length of query: 496 Effective length of database: 302 Effective search space: 149792 Effective search space used: 149792 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory