Align Branched-chain amino acid aminotransferase (EC 2.6.1.42) (characterized)
to candidate WP_015933570.1 MNOD_RS34390 branched-chain amino acid aminotransferase
Query= reanno::BFirm:BPHYT_RS16285 (307 letters) >NCBI__GCF_000022085.1:WP_015933570.1 Length = 295 Score = 231 bits (589), Expect = 2e-65 Identities = 119/263 (45%), Positives = 165/263 (62%), Gaps = 5/263 (1%) Query: 6 RDGKIWMDGKLIDWRDAKIHVLTHTLHYGMGVFEGVRAYKTADGGTAIFRLQEHTKRLLN 65 R+G IW DG+++ W DAKIHVLTH LHYG VFEG RAY G IF+ EH+ RL Sbjct: 9 REGHIWFDGRMVPWADAKIHVLTHGLHYGSCVFEGERAY-----GGQIFKSTEHSARLRR 63 Query: 66 SAKIFQMDVPFDHETLAAAQCEVVRENKLESCYLRPIIWVGSEKLGVSAKGNTIHVAIAA 125 SA++ ++PF + AA+ V++E+ L YLRP+ W GSE +GVSA+ NTIH+AIAA Sbjct: 64 SAELLDFEIPFSVAEIDAAKALVLKESGLSDAYLRPVAWRGSEMMGVSAQHNTIHLAIAA 123 Query: 126 WPWGAYLGEDGIAKGIRVKTSSFTRHHVNVSMVRAKASGWYVNSILANQEAIADGYDEAL 185 W W +Y KGIR+ + + R + +KA+G Y+ ++ A GY +AL Sbjct: 124 WEWPSYFDPATKMKGIRLDLADYRRPDPRTAPSASKAAGLYMICTISKHRAERKGYADAL 183 Query: 186 LLDVDGYVSEGSGENFFLVNNGKLYTPDLSSCLDGITRDTVITLARDAGIQVIEKRITRD 245 +LD + V+E +G N F + +G ++TP LDGITR TVI LAR G +V+E+RI + Sbjct: 184 MLDWEDNVAECTGANVFFIKDGVVHTPIADRFLDGITRQTVIELARRRGYEVVERRIRPE 243 Query: 246 EVYTCDEAFFTGTAAEVTPIREL 268 E+ E F TG+AAEVTP+ E+ Sbjct: 244 EMAGFTECFITGSAAEVTPVSEI 266 Lambda K H 0.319 0.136 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 252 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 295 Length adjustment: 27 Effective length of query: 280 Effective length of database: 268 Effective search space: 75040 Effective search space used: 75040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_015933570.1 MNOD_RS34390 (branched-chain amino acid aminotransferase)
to HMM TIGR01122 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01122.hmm # target sequence database: /tmp/gapView.22706.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01122 [M=298] Accession: TIGR01122 Description: ilvE_I: branched-chain amino acid aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-84 270.1 0.0 1.4e-84 269.8 0.0 1.0 1 lcl|NCBI__GCF_000022085.1:WP_015933570.1 MNOD_RS34390 branched-chain amin Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000022085.1:WP_015933570.1 MNOD_RS34390 branched-chain amino acid aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 269.8 0.0 1.4e-84 1.4e-84 1 283 [. 14 287 .. 14 294 .. 0.95 Alignments for each domain: == domain 1 score: 269.8 bits; conditional E-value: 1.4e-84 TIGR01122 1 wldGelvdvedakvhvlthalhYGtgvfeGiRaYetdkglaifrlkehveRlydsakilrleipyskee 69 w+dG++v+++dak+hvlth+lhYG+ vfeG RaY + +if+ +eh Rl sa+ l++eip+s e lcl|NCBI__GCF_000022085.1:WP_015933570.1 14 WFDGRMVPWADAKIHVLTHGLHYGSCVFEGERAYGG----QIFKSTEHSARLRRSAELLDFEIPFSVAE 78 9*********************************99....9**************************** PP TIGR01122 70 lvevtkevlrknnlksaYiRplvyvGaedlglkpkvdlkveviiaawewgaylgeealekGikvkvssf 138 + + vl++++l++aY+Rp++++G+e +g++++ + +++++iaawew+ y++ + kGi+ ++ + lcl|NCBI__GCF_000022085.1:WP_015933570.1 79 IDAAKALVLKESGLSDAYLRPVAWRGSEMMGVSAQHN-TIHLAIAAWEWPSYFDPATKMKGIRLDLADY 146 **********************************555.9****************************** PP TIGR01122 139 rraavnsiptkakaagnYlnsllaksealraGydeailLdeeGyvaeGsGenifivkdgvlltPpvses 207 rr ++ + p++ kaag Y+ ++ k+ a r+Gy +a++Ld e +vae +G n+f +kdgv+ tP + lcl|NCBI__GCF_000022085.1:WP_015933570.1 147 RRPDPRTAPSASKAAGLYMICTISKHRAERKGYADALMLDWEDNVAECTGANVFFIKDGVVHTPIA-DR 214 ****************************************************************99.99 PP TIGR01122 208 iLkgitrdaviklakelgievkeerisreelytaDevfltGtaaevtPirevDgrkigegkrGpvtkkl 276 L+gitr++vi+la+++g+ev+e+ri ee+ e f+tG+aaevtP+ e+ + +t++l lcl|NCBI__GCF_000022085.1:WP_015933570.1 215 FLDGITRQTVIELARRRGYEVVERRIRPEEMAGFTECFITGSAAEVTPVSEIGPYRFQ---PATMTRTL 280 ***************************************************9887664...44567888 PP TIGR01122 277 qeaffdl 283 ++ ++ lcl|NCBI__GCF_000022085.1:WP_015933570.1 281 MDDYSAE 287 8877765 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (295 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 8.74 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory