Align Phosphoserine aminotransferase; Phosphohydroxythreonine aminotransferase; PSAT; EC 2.6.1.52 (characterized)
to candidate WP_015818676.1 TERTU_RS12145 phosphoserine transaminase
Query= SwissProt::P52878 (370 letters) >NCBI__GCF_000023025.1:WP_015818676.1 Length = 372 Score = 499 bits (1285), Expect = e-146 Identities = 232/369 (62%), Positives = 290/369 (78%) Query: 1 MKPTRVPNNPCFSSGPCAKHPGYSIEELKDTPFGRSHRSNLGKEKLAEAIKKTRDMLGLP 60 M+P P NP FSSGPC+K PGY + +L GRSHRS+LGK LAE ++T +LGLP Sbjct: 1 MQPQVKPQNPNFSSGPCSKRPGYDVSKLALETLGRSHRSSLGKTVLAEVCEETAKVLGLP 60 Query: 61 DDYLVGIVPASDTGAFEMCLWSMLGCRGVDVLVWESFSKGWATDITKQLKLKDVRVFEAE 120 + Y VG+VP SDTGA EM +WS+LG RGVDVL WESF GW TDITKQLKL+DV + EAE Sbjct: 61 EGYRVGVVPGSDTGAVEMAMWSLLGARGVDVLAWESFGSGWVTDITKQLKLQDVIIREAE 120 Query: 121 YGKLPDLKKVDFKNDVVFVWNGTTSGVKVPNGDWIPENREGLTLCDATSAIFAMDIPYHK 180 YG+LP+L +V+F NDVVF +NGTTSGVKVPNGDWIP +R GLT+CDATSA+FAM++P+ K Sbjct: 121 YGELPNLDEVNFDNDVVFTYNGTTSGVKVPNGDWIPADRNGLTICDATSAVFAMEMPWEK 180 Query: 181 LDVITFSWQKVLGGEGAHGMLILSPRAVQRLESYTPAWPLPKIFRLTKGGKLNKKIFEGS 240 LDV+T+SWQKVLGGEGAHGMLILSPRAV+RLE+YTP WP+PK+FR+TKGGKL IF G Sbjct: 181 LDVVTYSWQKVLGGEGAHGMLILSPRAVERLETYTPPWPMPKLFRMTKGGKLVDGIFRGE 240 Query: 241 TINTPSMLANEDWLATLKWAESVGGLKPLIQRTNDNLAVFEAFVAKNNWIHFLAETKEIR 300 TINTPSML D+L L W +S+GG++ I ++ NLAV E +V +N+WI FLA+ +R Sbjct: 241 TINTPSMLCVADYLDALNWVKSLGGVEASIAKSQSNLAVIERYVEQNDWIEFLAQDPALR 300 Query: 301 SSTSVCFKVDLSDEKLKELIKTLEKEKVAYDIGSYRDAPSGLRIWCGATVEKEDLQCLCE 360 S+TSVC + + +++K ++K L+KE +AYDIG+YRDAP+GLR+W GATVE DL+ L Sbjct: 301 SNTSVCLTLKATPDQVKAIVKLLDKEGIAYDIGAYRDAPAGLRLWAGATVEAADLEALMP 360 Query: 361 WIEWAYNLV 369 WI WAY V Sbjct: 361 WIGWAYQEV 369 Lambda K H 0.318 0.136 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 489 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 370 Length of database: 372 Length adjustment: 30 Effective length of query: 340 Effective length of database: 342 Effective search space: 116280 Effective search space used: 116280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_015818676.1 TERTU_RS12145 (phosphoserine transaminase)
to HMM TIGR01365 (phosphoserine aminotransferase (EC 2.6.1.52))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01365.hmm # target sequence database: /tmp/gapView.18269.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01365 [M=374] Accession: TIGR01365 Description: serC_2: phosphoserine aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-190 618.9 0.1 1.9e-190 618.7 0.1 1.0 1 lcl|NCBI__GCF_000023025.1:WP_015818676.1 TERTU_RS12145 phosphoserine tran Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000023025.1:WP_015818676.1 TERTU_RS12145 phosphoserine transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 618.7 0.1 1.9e-190 1.9e-190 1 373 [. 6 368 .. 6 369 .. 0.99 Alignments for each domain: == domain 1 score: 618.7 bits; conditional E-value: 1.9e-190 TIGR01365 1 rpanpefssgpcakrpgysveelknaalgrshrsklgkeklkeaiektrevlevpadyligivaasdtg 69 +p+np+fssgpc+krpgy v +l +lgrshrs lgk+ l+e e+t +vl++p+ y++g+v++sdtg lcl|NCBI__GCF_000023025.1:WP_015818676.1 6 KPQNPNFSSGPCSKRPGYDVSKLALETLGRSHRSSLGKTVLAEVCEETAKVLGLPEGYRVGVVPGSDTG 74 599****************************************************************** PP TIGR01365 70 avemalwsllgargvdllafesfgkgwvtdvtkqlklkdvrvleaeygklpdlkkvdfkkdvvftwngt 138 avema+wsllgargvd+la+esfg+gwvtd+tkqlkl+dv + eaeyg+lp+l v+f++dvvft+ngt lcl|NCBI__GCF_000023025.1:WP_015818676.1 75 AVEMAMWSLLGARGVDVLAWESFGSGWVTDITKQLKLQDVIIREAEYGELPNLDEVNFDNDVVFTYNGT 143 ********************************************************************* PP TIGR01365 139 tsgvrvpngdfipadreglticdatsaafaqdldyekldvvtfswqkvlggegahgvlilspravarle 207 tsgv+vpngd+ipadr+glticdatsa+fa+++++ekldvvt+swqkvlggegahg+lilsprav+rle lcl|NCBI__GCF_000023025.1:WP_015818676.1 144 TSGVKVPNGDWIPADRNGLTICDATSAVFAMEMPWEKLDVVTYSWQKVLGGEGAHGMLILSPRAVERLE 212 ********************************************************************* PP TIGR01365 208 sytpawplpkifrltkggklskdifegetintpsmlavedaldalkwaesigglkalvaraddnlavle 276 +ytp wp+pk+fr+tkggkl ++if+getintpsml+v d+ldal+w +s+gg++a +a++++nlav+e lcl|NCBI__GCF_000023025.1:WP_015818676.1 213 TYTPPWPMPKLFRMTKGGKLVDGIFRGETINTPSMLCVADYLDALNWVKSLGGVEASIAKSQSNLAVIE 281 ********************************************************************* PP TIGR01365 277 afvaksswvdflaatkeirsntsvclkvvdpdvaaldedaqadfakelvsalekegvaydigsyrdapa 345 +v++++w++fla+ +++rsntsvcl + +a++++ +k +v++l+keg+aydig+yrdapa lcl|NCBI__GCF_000023025.1:WP_015818676.1 282 RYVEQNDWIEFLAQDPALRSNTSVCLTL-----KATPDQ-----VKAIVKLLDKEGIAYDIGAYRDAPA 340 **************************99.....555555.....9************************ PP TIGR01365 346 glriwcgatveksdleallewldwafal 373 glr+w gatve+ dleal++w+ wa++ lcl|NCBI__GCF_000023025.1:WP_015818676.1 341 GLRLWAGATVEAADLEALMPWIGWAYQE 368 **************************75 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (374 nodes) Target sequences: 1 (372 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 12.13 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory