Align Threonine synthase; TS; EC 4.2.3.1 (uncharacterized)
to candidate WP_012851176.1 TCUR_RS03920 threonine synthase
Query= curated2:Q58860 (405 letters) >NCBI__GCF_000024385.1:WP_012851176.1 Length = 413 Score = 254 bits (650), Expect = 2e-72 Identities = 143/381 (37%), Positives = 223/381 (58%), Gaps = 12/381 (3%) Query: 5 CIKCGKTYDVDEIIYTCE-CGGLLEIIYDYEEIKDKVSEEKLRKREIGVWRYLEYLPVKD 63 C +CG++Y++ Y CE C G LEI YD+ V+ E + +WRY LPV Sbjct: 16 CRECGQSYELGPR-YACEQCFGPLEIAYDFAG----VTRESIESGPRNIWRYRGLLPVPA 70 Query: 64 ESKIVSLCEGG-TPLYRCNNLEKELGIKELYVKNEGANPTGSFKDRGMTVGVTRANELGV 122 + E G T L R ++L + LG+++L+VK++ NPT SFKDR + V + A ELG Sbjct: 71 NVESTPNTEPGFTRLVRADHLAESLGMQKLWVKDDSGNPTHSFKDRVVAVALAAARELGF 130 Query: 123 EVVGCASTGNTSASLAAYSARSGKKCIVLLPEGKVALGKLAQAMFYGAKVIQVKGNFDDA 182 +V+ C STGN + ++AA +AR+G + V +P + K+ YG + V+GN+DD Sbjct: 131 KVLACPSTGNLANAVAAAAARAGIRSAVFVP-ADLEQQKIITTAVYGGTFVTVRGNYDDV 189 Query: 183 LDMVKQLAKEKLIYLLNSIN--PFRLEGQKTIAFEICDQLNWQVPDRVIVPVGNAGNISA 240 + ++A E+ + ++N P+ EG KT+ +EI +QL W++PD++++PV + ++ Sbjct: 190 NRLASEIAGEQEDWAFVNVNVRPYYAEGSKTLGYEIAEQLGWRLPDQIVIPVASGSQLTK 249 Query: 241 IWKGFKEFEITGIIDELP-KMTGIQADGAKPIVEAFRKRAKDIIPYKNPETIATAIRIGN 299 I K F+EF G++++ P K+ G QA G P+ AF K D++ P+TIA ++ IGN Sbjct: 250 IDKAFQEFIKLGLVEDKPYKVFGAQATGCSPVAAAF-KAGHDVVRPVKPDTIAKSLAIGN 308 Query: 300 PVNAPKALDAIYSSGGYAEAVTDEEIVEAQKLLARKEGIFVEPASASSIAGLKKLLEEGI 359 P + P LD + +GG E V+D E+VE +LLA EGIF E A ++A L+KL+ G Sbjct: 309 PADGPYVLDVVRRTGGAVEDVSDPEVVEGIRLLAATEGIFAETAGGVTVACLRKLIASGA 368 Query: 360 IDRDERIVCITTGHGLKDPDA 380 +D + V I +G GLK DA Sbjct: 369 LDPEAETVIINSGDGLKTLDA 389 Lambda K H 0.317 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 455 Number of extensions: 27 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 405 Length of database: 413 Length adjustment: 31 Effective length of query: 374 Effective length of database: 382 Effective search space: 142868 Effective search space used: 142868 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_012851176.1 TCUR_RS03920 (threonine synthase)
to HMM TIGR00260 (thrC: threonine synthase (EC 4.2.3.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00260.hmm # target sequence database: /tmp/gapView.28986.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00260 [M=340] Accession: TIGR00260 Description: thrC: threonine synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-87 280.3 0.0 1.3e-87 280.1 0.0 1.0 1 lcl|NCBI__GCF_000024385.1:WP_012851176.1 TCUR_RS03920 threonine synthase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000024385.1:WP_012851176.1 TCUR_RS03920 threonine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 280.1 0.0 1.3e-87 1.3e-87 1 339 [. 59 387 .. 59 388 .. 0.97 Alignments for each domain: == domain 1 score: 280.1 bits; conditional E-value: 1.3e-87 TIGR00260 1 vvryreilevt..ekdlvdlaegstelfrspklaeevgaenlyvkelfhgPtlaFKDrglqfvavlltk 67 ++ryr +l+v+ + + + g+t+l+r+++lae +g+++l+vk+++ +Pt +FKDr+ vav+l++ lcl|NCBI__GCF_000024385.1:WP_012851176.1 59 IWRYRGLLPVPanVESTPNTEPGFTRLVRADHLAESLGMQKLWVKDDSGNPTHSFKDRV---VAVALAA 124 8*********9644445567889************************************...******* PP TIGR00260 68 alelgnetvlcAtsGdtgaaaaealagkanvkvvvLyPkgkispvkeklvtalaenakvlaikGdFDda 136 a+elg ++++c ++G++++a+a a a++a+++ v++P++ ++ ++k++t+ +++ + + ++G++Dd+ lcl|NCBI__GCF_000024385.1:WP_012851176.1 125 ARELGFKVLACPSTGNLANAVA-AAAARAGIRSAVFVPAD-LE--QQKIITTAVYGGTFVTVRGNYDDV 189 **********************.*****************.99..************************ PP TIGR00260 137 qdlvkeifedkeklklnsvNsinparieaqktyafeiveqlgkespdkvvvpvp.sgnfgailkGflek 204 ++l ei++++e + +++vN + p++ e++kt+ +ei+eqlg++ pd++v+pv+ ++ +++i k+f+e+ lcl|NCBI__GCF_000024385.1:WP_012851176.1 190 NRLASEIAGEQEDWAFVNVN-VRPYYAEGSKTLGYEIAEQLGWRLPDQIVIPVAsGSQLTKIDKAFQEF 257 ********************.55*******************************7789*********** PP TIGR00260 205 kelg....lpieklaiaaegaadivrrflksgdlepkedkeTlstAmdignpsnveralelarrslgnl 269 +lg +p + +++a+g+++++ +f+ + d++ +++T++++++ignp++ +++l+++rr++g + lcl|NCBI__GCF_000024385.1:WP_012851176.1 258 IKLGlvedKPYKVFGAQATGCSPVAAAFKAGHDVVRPVKPDTIAKSLAIGNPADGPYVLDVVRRTGGAV 326 ********9*9*****************9888************************************* PP TIGR00260 270 edlkesvsdeeileaikklaeeegyllephtavavaalkklvekgvsatadpaKFeevvealtgnklkd 338 ed+ sd e++e i++la++eg+++e++++v+va l+kl+++g +dp+ +e+v + +g +lk+ lcl|NCBI__GCF_000024385.1:WP_012851176.1 327 EDV----SDPEVVEGIRLLAATEGIFAETAGGVTVACLRKLIASG---ALDPE--AETVIINSGDGLKT 386 ***....**************************************...*****..******9**99997 PP TIGR00260 339 p 339 lcl|NCBI__GCF_000024385.1:WP_012851176.1 387 L 387 5 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (340 nodes) Target sequences: 1 (413 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.17 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory