Align chorismate synthase (EC 4.2.3.5) (characterized)
to candidate WP_015738682.1 ADEG_RS03360 chorismate synthase
Query= BRENDA::Q71Y87 (388 letters) >NCBI__GCF_000024605.1:WP_015738682.1 Length = 388 Score = 418 bits (1074), Expect = e-121 Identities = 213/376 (56%), Positives = 275/376 (73%), Gaps = 3/376 (0%) Query: 1 MRYLTAGESHGPGLTTIIEGLPAGMPLLAEDVNKELKRRQGGHGRGARMRIEKDQVQITA 60 +RYLTAGESHG L TIIEG+PAG+ L A+ ++++L+RRQGG+GRGAR RIE+D+V+I + Sbjct: 2 LRYLTAGESHGQALLTIIEGMPAGLWLTADYIDRQLERRQGGYGRGARQRIERDRVEILS 61 Query: 61 GIRHGKTLGAPVAMFVENKDWKHWETVMSIEPVPEKNEKSRRVSRPRPGHADLVGGMKYG 120 G+R G TLG+P+A+ + N+DW++W VM+ P E R ++RPRPGHADL G +KY Sbjct: 62 GVRGGFTLGSPIALKIANRDWENWREVMN--PGLEARLDERVITRPRPGHADLAGALKYA 119 Query: 121 HNDMRNVLERSSARETTVRVAAGAVAKKLLHELGIEVAGHVLEIGGTRANLTRDYAVSEI 180 D+RNVLER+SARET RVAAGAVA++ L ELGI +AG V++IG +A + EI Sbjct: 120 FYDLRNVLERASARETVARVAAGAVARRFLEELGITLAGQVVQIGEVKAT-PAEGTPEEI 178 Query: 181 QETSEASPVRCLDGVAAEEMMQKIDDAKKNGDTIGGIVEVVVGGVPAGLGSYVQWDKKLD 240 + ++ASPV C D A+ M++ I+ A+K GDT+GGI EV V GVP GLGSYV WD++LD Sbjct: 179 RSQADASPVYCPDPQASAAMVEAIERAEKAGDTLGGIFEVRVYGVPPGLGSYVHWDRRLD 238 Query: 241 AKIARAIVSINAFKGAEFGVGFEAARKPGSEVMDEILWSKEDGYTRRTNNLGGFEGGMTN 300 ++A+A++SI KG E G+GF A PGS DEI +S GY R TN GG EGG+TN Sbjct: 239 GRLAQALMSIPGIKGVEIGLGFALASLPGSRAHDEIFYSPVQGYYRVTNRAGGLEGGVTN 298 Query: 301 GMPIVVRGVMKPIPTLYKPLQSVDIDSKETFNASVERSDSCAVPAASVVAEAVVAWEVAV 360 G PIVVR VMKPIPTL KPL+SVD+ +KE A+ ER+D CAVPAA V+ EAVVAWE+A Sbjct: 299 GEPIVVRAVMKPIPTLRKPLRSVDMFTKEPVAAAYERADICAVPAACVIGEAVVAWEIAA 358 Query: 361 AVLEKFDGDRFDTLKK 376 A LEKF GD LK+ Sbjct: 359 ACLEKFGGDTMAELKE 374 Lambda K H 0.315 0.133 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 456 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 388 Length adjustment: 30 Effective length of query: 358 Effective length of database: 358 Effective search space: 128164 Effective search space used: 128164 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
Align candidate WP_015738682.1 ADEG_RS03360 (chorismate synthase)
to HMM TIGR00033 (aroC: chorismate synthase (EC 4.2.3.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00033.hmm # target sequence database: /tmp/gapView.29158.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00033 [M=351] Accession: TIGR00033 Description: aroC: chorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-127 410.3 0.0 3.5e-127 410.1 0.0 1.0 1 lcl|NCBI__GCF_000024605.1:WP_015738682.1 ADEG_RS03360 chorismate synthase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000024605.1:WP_015738682.1 ADEG_RS03360 chorismate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 410.1 0.0 3.5e-127 3.5e-127 1 350 [. 2 366 .. 2 367 .. 0.96 Alignments for each domain: == domain 1 score: 410.1 bits; conditional E-value: 3.5e-127 TIGR00033 1 lrlttfGeSHgkalgaiidGlPaglelteediqkelkrRrpgqsrltrmrkEeDeveilsGvfeGkTtG 69 lr++t+GeSHg+al +ii+G+Pagl lt+++i ++l+rR+ g++r++r+r E+D+veilsGv+ G T G lcl|NCBI__GCF_000024605.1:WP_015738682.1 2 LRYLTAGESHGQALLTIIEGMPAGLWLTADYIDRQLERRQGGYGRGARQRIERDRVEILSGVRGGFTLG 70 699****************************************************************** PP TIGR00033 70 aPiallikNkd...........vrskdyedikelpRPgHadytylkKYgikd.regggrsSaReTaarv 126 +Pial i N+d ++++ e + ++pRPgHad+++ KY ++d r+ ++r+SaReT+arv lcl|NCBI__GCF_000024605.1:WP_015738682.1 71 SPIALKIANRDwenwrevmnpgLEARLDERVITRPRPGHADLAGALKYAFYDlRNVLERASARETVARV 139 ***********9888887666666666666*************************************** PP TIGR00033 127 aaGavakklLketagieivayvvklgeveleeesak.eiskerldkspvrcpdaeaekemeeeidkakk 194 aaGava+++L+e gi +++ vv++gev+++ + + e+++ ++d+spv cpd++a+++m+e i++a+k lcl|NCBI__GCF_000024605.1:WP_015738682.1 140 AAGAVARRFLEE-LGITLAGQVVQIGEVKATPAEGTpEEIRSQADASPVYCPDPQASAAMVEAIERAEK 207 ************.88************88776665568899**************************** PP TIGR00033 195 dgdsvGgvvevvvsnvpvglG..eplfdkldaelasallsinAvKgveiGdGFeaasvrGseanDelvl 261 +gd++Gg+ ev v++vp glG ++++++ld++la+al+si+ +KgveiG GF++as +Gs+a+De+ + lcl|NCBI__GCF_000024605.1:WP_015738682.1 208 AGDTLGGIFEVRVYGVPPGLGsyVHWDRRLDGRLAQALMSIPGIKGVEIGLGFALASLPGSRAHDEIFY 276 *********************999*******************************************99 PP TIGR00033 262 e.ddkirrktnnsGGieGGitnGedirvriavKpiptikkplktvdletkekakatkgRhDpcvvprav 329 + +++ r+tn+ GG+eGG+tnGe+i+vr+++Kpipt++kpl++vd+ tke++ a+++R D c+vp+a lcl|NCBI__GCF_000024605.1:WP_015738682.1 277 SpVQGYYRVTNRAGGLEGGVTNGEPIVVRAVMKPIPTLRKPLRSVDMFTKEPVAAAYERADICAVPAAC 345 9899***************************************************************** PP TIGR00033 330 pvvEamvalvladallekras 350 ++ Ea+va +a a+lek++ lcl|NCBI__GCF_000024605.1:WP_015738682.1 346 VIGEAVVAWEIAAACLEKFGG 366 ****************99875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (388 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.93 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory