Align fused D-3-phosphoglycerate dehydrogenase / phosphoserine phosphatase (EC 1.1.1.95; EC 3.1.3.3) (characterized)
to candidate WP_012818167.1 ADEG_RS00050 phosphoglycerate dehydrogenase
Query= reanno::Cola:Echvi_2777 (630 letters) >NCBI__GCF_000024605.1:WP_012818167.1 Length = 527 Score = 200 bits (508), Expect = 1e-55 Identities = 128/359 (35%), Positives = 198/359 (55%), Gaps = 18/359 (5%) Query: 235 VLLLENVHPIGVEIMKQEGYNVEV-VSSAMSEEELCEKIKNVSIIGIRSKTQITKKVLEN 293 VL+ + V P G++ + E +VEV ++EEEL E I + +RS T++T VLE Sbjct: 4 VLVTDGVSPEGLKALT-EAPDVEVDFRPTLNEEELKEIIGEYDALIVRSATKVTAAVLEK 62 Query: 294 ANRLMAVGAFCIGTNQIDLETCQEKGIAVFNAPFSNTRSVVELAISEIIFLMRNLHDKTL 353 A RL +G +G + ID++ KGI V NAP NT + E I ++ L RN+ + Sbjct: 63 ARRLKIIGRAGVGVDNIDVKAATAKGIIVANAPGGNTVAAAEHTIGLMLSLARNIPEACA 122 Query: 354 KMHQGIWNKSASGSFEVRGKKLGIIGYGNIGAQLSVLAENMGMNVFYYD--IVERLALGN 411 + G+W++ + E+RGK LGIIG G IG++++ A+ M M + YD I E A Sbjct: 123 RTKSGVWDRKSFMGVELRGKVLGIIGLGRIGSEVAKRAQAMEMKIIAYDPYIPEERARDL 182 Query: 412 ATKIDSLDELLETCDIISLHVDGRTENKNILNKEKIFKMKKGAILVNLSRGHVVDVPALR 471 K+ LD LL+ D I++H+ E +++++E KMK G L+N +RG +VD AL Sbjct: 183 RVKLVPLDTLLQEADFITIHIPLSKETYHLIDREAFVKMKPGVRLINCARGGIVDEEALY 242 Query: 472 DALESGHLAGAAVDVFPTEPKNNDEPFESELIGCPNTILTPHIGGSTLEAQENIAQFVPG 531 +AL+ G +AGAA+DVF EP + L PN ++TPH+G ST+EAQ +A+ + Sbjct: 243 EALKEGKVAGAALDVFEKEPVTS-----HPLFSLPNVVVTPHLGASTVEAQLAVAEVIAQ 297 Query: 532 KIIEYINSGNTFNSVNFPNIQL-------PFLKDAHRLIHIHQNAPGVLAKINQVLASY 583 +++ + G ++VN P ++ PFL A +L A V +INQV +Y Sbjct: 298 EVLTALRGGFVRHAVNLPYLRPEVLPVVGPFLPLAEKLGLF--AAQLVSGRINQVEVNY 354 Lambda K H 0.317 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 654 Number of extensions: 26 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 630 Length of database: 527 Length adjustment: 36 Effective length of query: 594 Effective length of database: 491 Effective search space: 291654 Effective search space used: 291654 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory