Align threonine synthase (EC 4.2.3.1) (characterized)
to candidate WP_015738594.1 ADEG_RS02880 threonine synthase
Query= BRENDA::Q8YFS0 (463 letters) >NCBI__GCF_000024605.1:WP_015738594.1 Length = 500 Score = 288 bits (736), Expect = 4e-82 Identities = 175/440 (39%), Positives = 254/440 (57%), Gaps = 20/440 (4%) Query: 1 MKYVSTRGEAPVLGFSDALLAGLARDGGLYLPQEYPQFTAEQIRALRGKSYVEVALAVLT 60 M Y STRG+AP + ++ +L GLA DGGLY+P+ +P+ I L SY E A+ +++ Sbjct: 1 MLYESTRGQAPPVKAAETILQGLAPDGGLYVPEFFPRLRFSSIEELSRHSYPEQAVRLIS 60 Query: 61 PFTGGEIPAADFERMVREAYGTFRHDA--VCPLVQTDANEFVLELFHGPTLAFKDVAMQL 118 F PA + V AY + D + PL + +LEL+HGPT AFKD+A+ L Sbjct: 61 LFLTDFSPA-EVSSAVLAAYNPLKFDTEEIVPLKVLAPDVGILELWHGPTHAFKDLALTL 119 Query: 119 LARMMDYVLAQRG--ERATIVGATSGDTGGAAIEAFGGRDNTDIFILFPNGRVSPVQQRQ 176 L +M + G + I+ ATSGDTG AA+E+F T I + FP+ VS +Q+RQ Sbjct: 120 LPHLMTRATQKLGLEKEIVILVATSGDTGKAALESFRDVPKTRIIVFFPSEGVSEIQKRQ 179 Query: 177 MTSSGFSNVHALSIEGNFDDCQNLVKGMFNDLEF-----CDALSLSGVNSINWARIMPQV 231 M + N +++EGNFDD Q+ VK +F D E ++ S NSINW R++PQV Sbjct: 180 MITQEGENTFVVAVEGNFDDAQSGVKQLFGDPELRRKMESAGMTFSSANSINWGRLLPQV 239 Query: 232 VYYFTAAL-----SLGAPDRAVSFTVPTGNFGDIFAGYVAKRMGLPIEQLIIATNDNDIL 286 VYYF+A L ++F VPTGNFG+I AG++A+ MGLP+ +LI+A N N++L Sbjct: 240 VYYFSAYARLLRDKLIRHGEEINFVVPTGNFGNILAGFLAREMGLPVRRLILAANANNVL 299 Query: 287 SRTLESGAYE-MRGVAQTTSPSMDIQISSNFERLLFEAHGRDAAAVRGLMQGLKQSGGFT 345 + + +G Y+ R +T SPSMDI ISSN ERLL+ R+A VR M L ++G + Sbjct: 300 TDFINTGIYDRRRPFHRTISPSMDILISSNLERLLYLVTDRNAEKVRQWMTSLARTGVYQ 359 Query: 346 ISEKPLSAIRSEFSAGRSTVDETAATIESVLSKDGYLLDPHSAIGVKV---AREKASGTA 402 I + I+ F + ++ DET A I+ ++ GYLLDPH+ + V RE+ + Sbjct: 360 IDQATHERIKQVFWSSWASDDETLAAIKDAYTRYGYLLDPHTGVAWHVFNRYREETGDST 419 Query: 403 PMVVLATAHPAKFP-DAVKA 421 V+L+TA P KF D ++A Sbjct: 420 KTVILSTASPFKFARDVIRA 439 Lambda K H 0.320 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 510 Number of extensions: 36 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 463 Length of database: 500 Length adjustment: 34 Effective length of query: 429 Effective length of database: 466 Effective search space: 199914 Effective search space used: 199914 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate WP_015738594.1 ADEG_RS02880 (threonine synthase)
to HMM TIGR00260 (thrC: threonine synthase (EC 4.2.3.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00260.hmm # target sequence database: /tmp/gapView.11801.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00260 [M=340] Accession: TIGR00260 Description: thrC: threonine synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-77 246.1 0.0 3.7e-77 245.7 0.0 1.1 1 lcl|NCBI__GCF_000024605.1:WP_015738594.1 ADEG_RS02880 threonine synthase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000024605.1:WP_015738594.1 ADEG_RS02880 threonine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 245.7 0.0 3.7e-77 3.7e-77 29 336 .. 87 445 .. 64 449 .. 0.87 Alignments for each domain: == domain 1 score: 245.7 bits; conditional E-value: 3.7e-77 TIGR00260 29 pkla.eevgaenlyvkelfhgPtlaFKDrglqfvavlltkalel.gne...tvlcAtsGdtgaaaaeal 92 +++ +v a ++ ++el hgPt aFKD++l + l+t+a ++ g e ++l+AtsGdtg aa+e++ lcl|NCBI__GCF_000024605.1:WP_015738594.1 87 EEIVpLKVLAPDVGILELWHGPTHAFKDLALTLLPHLMTRATQKlGLEkeiVILVATSGDTGKAALESF 155 444345677789*******************99999999887742333455****************** PP TIGR00260 93 agkanvkvvvLyPkgkispv.keklvtalaenakvlaikGdFDdaqdlvkeifedke........klkl 152 + + +++v+ P+ ++s + k +++t+ en v+a++G+FDdaq vk++f+d e + + lcl|NCBI__GCF_000024605.1:WP_015738594.1 156 RDVPKTRIIVFFPSEGVSEIqKRQMITQEGENTFVVAVEGNFDDAQSGVKQLFGDPElrrkmesaGMTF 224 ******************************************************7667778889899** PP TIGR00260 153 nsvNsinparieaqktyafeiveqlgk....espdkvvvpvpsgnfgailkGflekkelglpieklaia 217 +s+Nsin++r++ q++y+f++ ++l + ++ +++ ++vp gnfg+il+Gfl+ +++ lp++ l a lcl|NCBI__GCF_000024605.1:WP_015738594.1 225 SSANSINWGRLLPQVVYYFSAYARLLRdkliRHGEEINFVVPTGNFGNILAGFLAREMG-LPVRRLILA 292 ***********************99887778889********************99999.**8888777 PP TIGR00260 218 aegaadivrrflksgdlepkedk..eTlstAmdignpsnverale.larrslgnledlke......... 274 a+ + ++++ f+++g ++ ++++ T+s++mdi+++sn er+l + r+ +++ + lcl|NCBI__GCF_000024605.1:WP_015738594.1 293 ANAN-NVLTDFINTG-IYDRRRPfhRTISPSMDILISSNLERLLYlVTDRNAEKVR---Qwmtslartg 356 7776.**********.777777778********************44444444444...34458999** PP TIGR00260 275 ...................svsdeeileaikklaeeegyllephtavavaalkklvekg...vs....a 317 +sd+e+l aik ++ + gyll+pht+va + ++ e++ + + lcl|NCBI__GCF_000024605.1:WP_015738594.1 357 vyqidqatherikqvfwssWASDDETLAAIKDAYTRYGYLLDPHTGVAWHVFNRYREETgdsTKtvilS 425 ******************999************************************99876226789* PP TIGR00260 318 tadpaKFeevve.altgnkl 336 ta+p KF++ v al +kl lcl|NCBI__GCF_000024605.1:WP_015738594.1 426 TASPFKFARDVIrALAPEKL 445 ********999878876665 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (340 nodes) Target sequences: 1 (500 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.38 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory