Align Valine--pyruvate aminotransferase; Alanine--valine transaminase; EC 2.6.1.66 (characterized)
to candidate WP_015739359.1 ADEG_RS06970 pyridoxal phosphate-dependent aminotransferase
Query= SwissProt::P96847 (388 letters) >NCBI__GCF_000024605.1:WP_015739359.1 Length = 398 Score = 152 bits (384), Expect = 2e-41 Identities = 117/384 (30%), Positives = 177/384 (46%), Gaps = 23/384 (5%) Query: 13 PFYVMDVWLAAAERQRTHGDLVNLSAGQPSAGAPEPVRAAAAAALHLNQLGYSVALGIPE 72 P + V A E R ++N AG+P PE ++ AA AL Y+ GI Sbjct: 13 PSPTLSVDTKAKELLRQGERVINFGAGEPDFDTPEHIKEAAKRALDQGFTKYTPVAGILP 72 Query: 73 LRDAIAADYQRRHGITVEPDAVVITTGSSGGFLLAFLACFDAGDRVAMASPGYPCYRNIL 132 LR+AI R + + P+ +V++ G+ A D GD V + P + Y + Sbjct: 73 LREAICEKLYRDNQLEYSPNEIVVSCGAKHSIFNALQVLLDPGDEVIIPVPYWTSYPEQV 132 Query: 133 SALGCEVVEIPCGPQTRFQPTAQML-AEIDPPLRGVVVASPANPTGTVIPPEELAAIASW 191 G V +P P+ F+ + L A + P R +++ SPANPTGTV EEL +A Sbjct: 133 KLAGGVPVFVPTSPENDFKLRPEDLRAAVTPRTRLLILNSPANPTGTVYRREELIGLAEV 192 Query: 192 CDASDVRLISDEVYHGLVYQGAPQTSCAW---QTSRNAVVVNSFSKYYAMTGWRLGWLLV 248 +D+ ++SDE+Y L+Y G S A + + +VVN SK YAMTGWR+G+ Sbjct: 193 ALEADLWILSDEIYEKLIYDGMEHVSIAALDPEVKKRTIVVNGVSKAYAMTGWRIGYAAA 252 Query: 249 PTVLRRAVDCLTGNFTICPPVLSQIAAVSAFT-PEATAEADGNLASYAINRSLLLDGLRR 307 P + +A+ L + T P ++Q AA++A P+ E ++ R + L Sbjct: 253 PRPIAQAMTNLQSHSTSNPTSVAQAAALAALKGPQEPVE--NMRRAFQKRRDFIWQYLNS 310 Query: 308 IGIDRLAPTDGAFYVYADVSDF-----------TSDSLAFCSKLLADTGVAIAPGIDFDT 356 + R GAFYV+ +VS T+ LA LL + VA G F Sbjct: 311 LPGVRCPKPLGAFYVFPEVSGLLGRRLKGREIATASDLALF--LLEEIKVATVAGAAFGD 368 Query: 357 ARGGSFVRISFAGPSGDIEEALRR 380 R ++R S+A DIEE ++R Sbjct: 369 DR---YLRFSYALRLEDIEEGMQR 389 Lambda K H 0.321 0.136 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 371 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 398 Length adjustment: 31 Effective length of query: 357 Effective length of database: 367 Effective search space: 131019 Effective search space used: 131019 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory