Align Probable acetolactate synthase large subunit; AHAS; EC 2.2.1.6; Acetohydroxy-acid synthase large subunit; ALS (uncharacterized)
to candidate WP_012967975.1 KVAR_RS11035 acetolactate synthase AlsS
Query= curated2:O08353 (599 letters) >NCBI__GCF_000025465.1:WP_012967975.1 Length = 559 Score = 239 bits (611), Expect = 2e-67 Identities = 165/556 (29%), Positives = 272/556 (48%), Gaps = 30/556 (5%) Query: 2 NGAEAMIKALEAEKVEILFGYPGGALLPFYDALHHSDLIHLLTRHEQAAAHAADGYARAS 61 +GA+ ++ LEA+ V +FG PG + +D+L S + + RHE AA A R + Sbjct: 12 HGADLVVSQLEAQGVRQIFGIPGAKIDKVFDSLLDSSIRIIPVRHEANAAFMAAAVGRIT 71 Query: 62 GKVGVCIGTSGPGATNLVTGVATAHSDSSPMVALTGQVPTKLIGNDAFQEIDALGLFMPI 121 GK GV + TSGPG +NL+TG+ATA+S+ P+V L G V Q +D + +F P+ Sbjct: 72 GKAGVALVTSGPGCSNLITGMATANSEGDPVVTLGGAVKRADKAKQVHQSMDTVAMFSPV 131 Query: 122 VKHNFQIQKTCQIPEIFRSAFEIAQTGRPGPVHIDLPKDVQELELDIDKHPIPSKVKLIG 181 K+ ++ + E+ +AF A+ GRPG + LP+DV + P+ KV Sbjct: 132 TKYAVEVTAPDALAEVVSNAFRAAEQGRPGSAFVSLPQDVVD-------GPVSGKVLPAS 184 Query: 182 YNPTTIGHPRQ-IKKAIKLIASAKRPIILAGGGVLLSGANEELLKLVELLNIPVCTTLMG 240 P P I + KLIA AK PI L G + L +L+E +IPV +T Sbjct: 185 RAPQMGAAPDDAIDQVAKLIAQAKNPIFLLGLMASQPENSAALRRLLEASHIPVTSTYQA 244 Query: 241 KGCIS-ENHPLALGMVGMHGTKPANYCLSESDVLISIGCRFSDRITGDIKSFATNAKIIH 299 G ++ +N G VG+ + + L +D++I IG +S + NA ++H Sbjct: 245 AGAVNQDNFSRFAGRVGLFNNQAGDRLLQLADLVICIG--YSPVEYEPAMWNSGNATLVH 302 Query: 300 IDIDPAEIGKNVNVDVPIVGDAKLILKEVIKQLDY--IINKDSKE-NNDKENISQWIENV 356 ID+ PA +N DV +VGD L ++ + +D+ +++ + E D+++ + ++ Sbjct: 303 IDVLPAYEERNYTPDVELVGDIAGTLNKLAQNIDHRLVLSPQAAEILRDRQHQRELLDRR 362 Query: 357 NSLKKSSIPVMDYDDIPIKPQKIVKELMAVIDDLNINKNTIITTDVGQNQMWMAHYFKTQ 416 + + + P +IV+ + + +N + +T D+G +W+A Y + Sbjct: 363 GA---------QLNQFALHPLRIVRAMQDI-----VNSDVTLTVDMGSFHIWIARYLYSF 408 Query: 417 TPRSFLSSGGLGTMGFGFPSAIGAKVAKPDSKVICITGDGGFMMNCQELGTIAEYNIPVV 476 R + S G TMG P AIGA + P+ KV+ ++GDGGF+ + EL T V+ Sbjct: 409 RARQVMISNGQQTMGVALPWAIGAWLVNPERKVVSVSGDGGFLQSSMELETAVRLKANVL 468 Query: 477 ICIFDNRTLGMVYQWQNLFYGKRQCSVNFGGAPDFIKLAESYGIKARRIESPNEINEALK 536 I+ + MV + Y +R V F G DF AES+G K +ES + L+ Sbjct: 469 HLIWVDNGYNMVAIQEEKKY-QRLSGVEF-GPMDFKAYAESFGAKGFAVESAEALEPTLR 526 Query: 537 EAINCDEPYLLDFAID 552 A++ D P ++ +D Sbjct: 527 AAMDVDGPAVVAIPVD 542 Lambda K H 0.319 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 666 Number of extensions: 29 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 599 Length of database: 559 Length adjustment: 36 Effective length of query: 563 Effective length of database: 523 Effective search space: 294449 Effective search space used: 294449 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory