Align acetohydroxyacid isomeroreductase (EC 1.1.1.86) (characterized)
to candidate WP_012970169.1 ALVIN_RS04710 ketol-acid reductoisomerase
Query= metacyc::MONOMER-18814 (338 letters) >NCBI__GCF_000025485.1:WP_012970169.1 Length = 340 Score = 498 bits (1282), Expect = e-146 Identities = 245/338 (72%), Positives = 283/338 (83%) Query: 1 MKVFYDKDADLSLIKGKNVTIIGYGSQGHAHALNLKDSGVNVTVGLRKSGASWNKAANAG 60 + V+YDKDADLSLI+GK VTI+GYGSQGHAHA NLKDSGV+VTV LR AS KA NAG Sbjct: 3 INVYYDKDADLSLIQGKKVTIVGYGSQGHAHANNLKDSGVSVTVALRPGSASAAKATNAG 62 Query: 61 LQVKEVAEAVKGADVVMILLPDEQIADVYKNEVHDNIKEGAALAFAHGFNVHYGAVIPRA 120 L VK + EAV ADVVMIL PDE +Y+ ++ NIK+GAALAFAHGFNVH+G + PR Sbjct: 63 LTVKPIEEAVADADVVMILAPDEHQGALYREQIEPNIKQGAALAFAHGFNVHFGQITPRE 122 Query: 121 DLDVIMIAPKAPGHTVRATYTQGGGVPHLIAVHQNKSGAARDIALSYATANGGGRAGIIE 180 DLDVIMIAPK PGH VR+TYTQGGGVP LIAV+Q+ SG ARDIA++YA+ANGGGRAGIIE Sbjct: 123 DLDVIMIAPKGPGHLVRSTYTQGGGVPSLIAVYQDASGQARDIAMAYASANGGGRAGIIE 182 Query: 181 TNFREETETDLFGEQAVLCGGTVELIKAGFETLVEAGYAPEMAYFECLHELKLIVDLIYE 240 T FREE ETDLFGEQ VLCGG LI+AGFETLVEAGYAPEMAYFECLHE+KLIVDLIYE Sbjct: 183 TTFREECETDLFGEQVVLCGGLTSLIQAGFETLVEAGYAPEMAYFECLHEVKLIVDLIYE 242 Query: 241 GGIANMNYSISNNAEYGEYVTGPRVVTEETKKAMKQCLTDIQTGEYAKSFLLENKAGAPT 300 GGIANM YSISN AEYG+ GPRV+T ETK MK+ LT+IQTG++AK F+LEN+AGA + Sbjct: 243 GGIANMRYSISNTAEYGDLTRGPRVITSETKAEMKRILTEIQTGQFAKEFMLENQAGAAS 302 Query: 301 LISRRRLTAEHQIEEVGAKLRAMMPWIAKNKMVDQSKN 338 + + RRL AEHQIEEVG +LR MMPWI + K+VD+++N Sbjct: 303 MKAMRRLGAEHQIEEVGERLREMMPWIREKKLVDKTRN 340 Lambda K H 0.316 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 443 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 340 Length adjustment: 28 Effective length of query: 310 Effective length of database: 312 Effective search space: 96720 Effective search space used: 96720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_012970169.1 ALVIN_RS04710 (ketol-acid reductoisomerase)
to HMM TIGR00465 (ilvC: ketol-acid reductoisomerase (EC 1.1.1.86))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00465.hmm # target sequence database: /tmp/gapView.7555.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00465 [M=314] Accession: TIGR00465 Description: ilvC: ketol-acid reductoisomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-142 460.5 0.9 1.4e-142 460.2 0.9 1.0 1 lcl|NCBI__GCF_000025485.1:WP_012970169.1 ALVIN_RS04710 ketol-acid reducto Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000025485.1:WP_012970169.1 ALVIN_RS04710 ketol-acid reductoisomerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 460.2 0.9 1.4e-142 1.4e-142 1 312 [. 16 328 .. 16 330 .. 0.99 Alignments for each domain: == domain 1 score: 460.2 bits; conditional E-value: 1.4e-142 TIGR00465 1 lkgkkvaiiGyGsqGeaqalnlrdsglnvivglrkeaaswkkAeedGfkvltveeaikkadlimiLlpD 69 ++gkkv+i+GyGsqG+a+a nl+dsg+ v+v+lr+++as +kA++ G+ v+ +eea+++ad++miL pD lcl|NCBI__GCF_000025485.1:WP_012970169.1 16 IQGKKVTIVGYGSQGHAHANNLKDSGVSVTVALRPGSASAAKATNAGLTVKPIEEAVADADVVMILAPD 84 689****************************************************************** PP TIGR00465 70 evqkevyeaeikpllkegkallfsHGfnivfkqivipkdvdvvlvAPKgpGalvReeykegrGvpsliA 138 e q + y+++i+p++k+g+al f+HGfn++f qi++++d+dv+++APKgpG+lvR++y +g GvpsliA lcl|NCBI__GCF_000025485.1:WP_012970169.1 85 EHQGALYREQIEPNIKQGAALAFAHGFNVHFGQITPREDLDVIMIAPKGPGHLVRSTYTQGGGVPSLIA 153 ********************************************************************* PP TIGR00465 139 veqdvtgeakeiAlayAkaiGgaragvlettFkeEvesDLfGEqavLcGglealikaafdtLveaGyqp 207 v+qd++g+a++iA+ayA a Gg+rag++ettF+eE+e+DLfGEq+vLcGgl+ li+a+f+tLveaGy+p lcl|NCBI__GCF_000025485.1:WP_012970169.1 154 VYQDASGQARDIAMAYASANGGGRAGIIETTFREECETDLFGEQVVLCGGLTSLIQAGFETLVEAGYAP 222 ********************************************************************* PP TIGR00465 208 elAyfeivhelklivdllkekGlelmrdavsntAklgalelr.eilkeelkkemqkilkeiqnGefake 275 e+Ayfe++he+klivdl++e+G+++mr ++sntA++g+l+++ ++++ e+k+em+ il eiq+G+fake lcl|NCBI__GCF_000025485.1:WP_012970169.1 223 EMAYFECLHEVKLIVDLIYEGGIANMRYSISNTAEYGDLTRGpRVITSETKAEMKRILTEIQTGQFAKE 291 ********************************************************************* PP TIGR00465 276 walekeagkpafeearkkekeqeiekvGkelralvka 312 ++le++ag+++++++r+ e++ie+vG++lr+++++ lcl|NCBI__GCF_000025485.1:WP_012970169.1 292 FMLENQAGAASMKAMRRLGAEHQIEEVGERLREMMPW 328 ***********************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (314 nodes) Target sequences: 1 (340 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.96 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory