Align Aspartate--tRNA(Asp/Asn) ligase; Aspartyl-tRNA synthetase; AspRS; Non-discriminating aspartyl-tRNA synthetase; ND-AspRS; EC 6.1.1.23 (characterized)
to candidate WP_012966017.1 FERP_RS07595 aspartate--tRNA(Asn) ligase
Query= SwissProt::Q8Q0R2 (444 letters) >NCBI__GCF_000025505.1:WP_012966017.1 Length = 429 Score = 536 bits (1380), Expect = e-157 Identities = 258/423 (60%), Positives = 329/423 (77%), Gaps = 7/423 (1%) Query: 22 GQKVTLAGWVHEVRDLGGICFVVLRDREGKAQVTLVKKKIDKDLFDAARRLVRESVISVT 81 G+KVTL GW+HEVRDLGG+ FVVLRDREG AQ+TL KKK+ +++F+ A+ + RESV+ V Sbjct: 14 GKKVTLYGWIHEVRDLGGLVFVVLRDREGFAQITLPKKKVKQEVFERAKNVRRESVVKVV 73 Query: 82 GSVKFEEKAPNGYELLPDEINVLNVSGSPLPMDTTGKVEAELDTRLDSRFIDLRRAETTA 141 G VK EE+APNG+E++P+E VLN + +PLP+D T KV AELDTRLD RF+DLR+ A Sbjct: 74 GEVKKEERAPNGFEIIPEEFEVLNEADAPLPLDVTEKVPAELDTRLDHRFLDLRKHRVFA 133 Query: 142 VFKIRHESLRAIREYFVKYNFIETATPKVVATATEGGTALFPITYFDREAFLNQSPQLFK 201 +F++R E L A RE+F + FIE TPK+V+TATEGGT LFPITYF+REAFLNQSPQL+K Sbjct: 134 IFRVRSEVLNATREFFHERGFIEVNTPKIVSTATEGGTELFPITYFEREAFLNQSPQLYK 193 Query: 202 QILMSGGFDRVFEIGPIFRAEEHDTRRHLNEATSIDVEVSFADHFDVMELLENLVAYVYT 261 Q LM+ GFDRVFEIGPIFRAEEH+T RHLNEATSID+EVSF DH VM+ LE L+ Y++ Sbjct: 194 QTLMAAGFDRVFEIGPIFRAEEHNTVRHLNEATSIDIEVSFTDHNGVMKYLEELIVYIHE 253 Query: 262 RVIENCKSSLEVLGVDLKVPKTPFLKLTYDEVIEIINSRCEEKMHWGDDLGTLGEHTVGD 321 RV+ENC+ L L V L+VP+ PF ++TYDE +EI++ + E++ WG+D T + + Sbjct: 254 RVVENCEKYLNWLNVKLEVPEKPFERITYDEALEIVSRK--EEIPWGEDFSTPALKVLAE 311 Query: 322 HVYETTGESHYFIIDWPTEIKPFYAMPYEDRPEFSKSFDMMHRTMELSSGAQRIHIPSLL 381 H+ + +YFI DWPTE KPFYAMPYE+R E KSFD+M +EL+SGAQRIH LL Sbjct: 312 HM-----QGYYFITDWPTESKPFYAMPYENRKEICKSFDLMKGWLELASGAQRIHKYDLL 366 Query: 382 KNRIESQGLNPDGFEFYLKAFEFGMPPHAGWGMGCERFVMTMLGTENIRDTVLFPRDRRR 441 RI++QGL+P+ F FYL+AF +GMPPHAGWG+G ER +M ML +NIR+ VLFPRDR+R Sbjct: 367 VERIKAQGLDPESFGFYLEAFRYGMPPHAGWGLGVERLLMAMLDLKNIREAVLFPRDRQR 426 Query: 442 LSP 444 L P Sbjct: 427 LVP 429 Lambda K H 0.321 0.138 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 566 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 444 Length of database: 429 Length adjustment: 32 Effective length of query: 412 Effective length of database: 397 Effective search space: 163564 Effective search space used: 163564 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate WP_012966017.1 FERP_RS07595 (aspartate--tRNA(Asn) ligase)
to HMM TIGR00458 (aspS: aspartate--tRNA(Asn) ligase (EC 6.1.1.23))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00458.hmm # target sequence database: /tmp/gapView.24653.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00458 [M=428] Accession: TIGR00458 Description: aspS_nondisc: aspartate--tRNA(Asn) ligase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-216 704.2 1.1 3.6e-216 704.1 1.1 1.0 1 lcl|NCBI__GCF_000025505.1:WP_012966017.1 FERP_RS07595 aspartate--tRNA(Asn Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000025505.1:WP_012966017.1 FERP_RS07595 aspartate--tRNA(Asn) ligase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 704.1 1.1 3.6e-216 3.6e-216 3 428 .] 5 429 .] 3 429 .] 0.99 Alignments for each domain: == domain 1 score: 704.1 bits; conditional E-value: 3.6e-216 TIGR00458 3 sadikeekdgkevllrgwvheirdlGalifvllrdregliqilvkkkkvskelfklikklkkesvvavk 71 + +i ee gk+v+l+gw+he+rdlG+l+fv+lrdreg qi+++kkkv++e+f+ +k++++esvv v lcl|NCBI__GCF_000025505.1:WP_012966017.1 5 TSEISEEDFGKKVTLYGWIHEVRDLGGLVFVVLRDREGFAQITLPKKKVKQEVFERAKNVRRESVVKVV 73 568999999************************************************************ PP TIGR00458 72 GkvkekekapqgleiipeklevlneakeplPldleekveaeldtrldarfldlrrpkvqaifkirsevl 140 G+vk++e+ap+g+eiipe++evlnea++plPld++ekv+aeldtrld+rfldlr+ +v aif++rsevl lcl|NCBI__GCF_000025505.1:WP_012966017.1 74 GEVKKEERAPNGFEIIPEEFEVLNEADAPLPLDVTEKVPAELDTRLDHRFLDLRKHRVFAIFRVRSEVL 142 ********************************************************************* PP TIGR00458 141 esvreflaeegfievntPklvasateGGtelfeityfereaflaqsPqlykqvllaaglervyeiaPif 209 ++ ref++e+gfievntPk+v++ateGGtelf+ityfereafl+qsPqlykq l+aag++rv+ei+Pif lcl|NCBI__GCF_000025505.1:WP_012966017.1 143 NATREFFHERGFIEVNTPKIVSTATEGGTELFPITYFEREAFLNQSPQLYKQTLMAAGFDRVFEIGPIF 211 ********************************************************************* PP TIGR00458 210 raeehntkrhlnevisidiemafedhkdvldileelvvrvfedvaeklkkelevlevklevpeeklerl 278 raeehnt rhlne++sidie++f+dh++v++ leel+v + e v e+++k+l++l+vklevpe+++er+ lcl|NCBI__GCF_000025505.1:WP_012966017.1 212 RAEEHNTVRHLNEATSIDIEVSFTDHNGVMKYLEELIVYIHERVVENCEKYLNWLNVKLEVPEKPFERI 280 ********************************************************************* PP TIGR00458 279 tydeaieilrakGkeikdgedlsteaekllGekmdglyfitdfPteikPfytmPdednPeisksfdlly 347 tydea+ei+++k +ei++ged+st a k+l e+m+g+yfitd+Pte+kPfy+mP+e++ ei+ksfdl+ lcl|NCBI__GCF_000025505.1:WP_012966017.1 281 TYDEALEIVSRK-EEIPWGEDFSTPALKVLAEHMQGYYFITDWPTESKPFYAMPYENRKEICKSFDLMK 348 *********987.89****************************************************** PP TIGR00458 348 rdleissGaqrihdydllvekikakGlePeslksyleafkyGmPPhaGwGlGaerlvmvlldlknirea 416 +le++sGaqrih+ydllve+ika+Gl+Pes+ +yleaf+yGmPPhaGwGlG+erl m++ldlknirea lcl|NCBI__GCF_000025505.1:WP_012966017.1 349 GWLELASGAQRIHKYDLLVERIKAQGLDPESFGFYLEAFRYGMPPHAGWGLGVERLLMAMLDLKNIREA 417 ********************************************************************* PP TIGR00458 417 vlfPrdrkrltP 428 vlfPrdr+rl+P lcl|NCBI__GCF_000025505.1:WP_012966017.1 418 VLFPRDRQRLVP 429 **********98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (428 nodes) Target sequences: 1 (429 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.39 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory