Align threonine synthase; EC 4.2.3.1 (characterized)
to candidate WP_012965250.1 FERP_RS03675 threonine synthase
Query= CharProtDB::CH_107419 (405 letters) >NCBI__GCF_000025505.1:WP_012965250.1 Length = 388 Score = 468 bits (1203), Expect = e-136 Identities = 242/400 (60%), Positives = 306/400 (76%), Gaps = 12/400 (3%) Query: 1 MYHLKCIECGAEYSRDEVIYTCSKCDGLLDVIYDYSSIKIDMEKLKTECPSVWKYAKLLP 60 MY L+CIECG+E+ D IY CSKC+GLLDV+YDYS IK++ + SVWKY LP Sbjct: 1 MYLLRCIECGSEFDSD-FIYQCSKCNGLLDVVYDYSEIKLNFDGNNL---SVWKYKDALP 56 Query: 61 VEREPVTIQEGGTPLYKCDRLAEKIGIKKLYVKHEGMNPTGSFKDRGMTVGVTKALELGM 120 V+ +PV+++EGGTPLYK +++ G+K L+VKHEG+NP+GSFKDRGMTVGVTKA+EL M Sbjct: 57 VKIKPVSLREGGTPLYKIEKIES--GVKNLFVKHEGLNPSGSFKDRGMTVGVTKAVELKM 114 Query: 121 NTVACASTGNTSAALAIYGAKAGIPVVVLLPAGKVALGKVAQALMHGAKVLSIRGNFDDA 180 TV CASTGNTSA++A+Y AKAG+ VV+LP+GKVALGK+AQALMHGAKV++++ NFD A Sbjct: 115 RTVICASTGNTSASMAMYAAKAGLRAVVILPSGKVALGKLAQALMHGAKVIAVKDNFDKA 174 Query: 181 LALVRTLCSQEKIYLLNSINPYRLEGQKTIGFEIADQLDFKVPDRIVLPVGNAGNITAIY 240 L +V++L ++ +YLLNSINP+RLEGQKTI +EI D+L F VPD I +PVGNAGNI+AIY Sbjct: 175 LEIVKSLAMRKSLYLLNSINPFRLEGQKTIAYEIYDELGF-VPDAIFVPVGNAGNISAIY 233 Query: 241 KGFREFKILGITDSLPKMTGIQAEGSCPIVKAIKSGAPAITPEENPETVATAIRIGNPVN 300 KGF+E +G TD +P+M G+QA+G+ PI KA G+ I P +NPET+ATAIRIG PVN Sbjct: 234 KGFKELVEMGYTDEVPRMIGVQAKGANPIYKAFVKGSREIEPVKNPETIATAIRIGAPVN 293 Query: 301 ATKALSAIRESGGTAESVTDEEILAAQKDLARLEGIGVEPASAASVAGLRKLVDMGVIGR 360 A KAL AI ES G V DEEI+ AQK LA EGIGVEPASAAS+AG K + Sbjct: 294 AKKALRAIYESKGAVIEVGDEEIVEAQKMLAAKEGIGVEPASAASLAGALKFEE-----E 348 Query: 361 DETVVCITTGHLLKDPQTVIDVCEEPTVVDANIDAIREAI 400 E+ VCI TG+LLKDP VI VC +P V+A++D I + + Sbjct: 349 LESAVCIATGNLLKDPDEVIRVCGKPIEVEADVDVIEKLL 388 Lambda K H 0.317 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 551 Number of extensions: 27 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 405 Length of database: 388 Length adjustment: 31 Effective length of query: 374 Effective length of database: 357 Effective search space: 133518 Effective search space used: 133518 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_012965250.1 FERP_RS03675 (threonine synthase)
to HMM TIGR00260 (thrC: threonine synthase (EC 4.2.3.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00260.hmm # target sequence database: /tmp/gapView.12239.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00260 [M=340] Accession: TIGR00260 Description: thrC: threonine synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-104 333.9 0.4 6.6e-104 333.7 0.4 1.0 1 lcl|NCBI__GCF_000025505.1:WP_012965250.1 FERP_RS03675 threonine synthase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000025505.1:WP_012965250.1 FERP_RS03675 threonine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 333.7 0.4 6.6e-104 6.6e-104 1 340 [] 48 365 .. 48 365 .. 0.97 Alignments for each domain: == domain 1 score: 333.7 bits; conditional E-value: 6.6e-104 TIGR00260 1 vvryreilevtekdlvdlaegstelfrspklaeevgaenlyvkelfhgPtlaFKDrglqfvavlltkal 69 v++y+ +l+v+ +++v+l eg t+l++ +k+++ v+ nl+vk+++++P+++FKDrg ++v++tka lcl|NCBI__GCF_000025505.1:WP_012965250.1 48 VWKYKDALPVK-IKPVSLREGGTPLYKIEKIESGVK--NLFVKHEGLNPSGSFKDRG---MTVGVTKAV 110 8*********8.*******************99886..5******************...********* PP TIGR00260 70 elgnetvlcAtsGdtgaaaaealagkanvkvvvLyPkgkispvkeklvtalaenakvlaikGdFDdaqd 138 el++ tv+cA++G+t+a++a ++a+ka++++vv++P+gk++ +kl++al+++akv+a+k +FD+a++ lcl|NCBI__GCF_000025505.1:WP_012965250.1 111 ELKMRTVICASTGNTSASMA-MYAAKAGLRAVVILPSGKVA--LGKLAQALMHGAKVIAVKDNFDKALE 176 ********************.********************..************************** PP TIGR00260 139 lvkeifedkeklklnsvNsinparieaqktyafeiveqlgkespdkvvvpvp.sgnfgailkGflekke 206 +vk+++ +k ++lns+N p+r+e+qkt+a+ei ++lg pd + vpv+ +gn++ai+kGf+e+ e lcl|NCBI__GCF_000025505.1:WP_012965250.1 177 IVKSLAMRKSLYLLNSIN---PFRLEGQKTIAYEIYDELG-FVPDAIFVPVGnAGNISAIYKGFKELVE 241 ****************99...*******************.9*************************** PP TIGR00260 207 lg....lpieklaiaaegaadivrrflksg.dlepkedkeTlstAmdignpsnveralelarrslgnle 270 +g +p ++++++a+ga++i+++f k+ ++ep +++eT++tA++ig p+n+++al+++++s+g + lcl|NCBI__GCF_000025505.1:WP_012965250.1 242 MGytdeVP-RMIGVQAKGANPIYKAFVKGSrEIEPVKNPETIATAIRIGAPVNAKKALRAIYESKGAVI 309 *****99*.*******************988************************************** PP TIGR00260 271 dlkesvsdeeileaikklaeeegyllephtavavaalkklvekgvsatadpaKFeevvealtgnklkdp 339 ++ deei+ea+k la++eg+ +ep++a+++a+ +k e+ e +v++ tgn lkdp lcl|NCBI__GCF_000025505.1:WP_012965250.1 310 EV----GDEEIVEAQKMLAAKEGIGVEPASAASLAGALKFEEEL----------ESAVCIATGNLLKDP 364 **....*********************************98855..........577999999999988 PP TIGR00260 340 e 340 + lcl|NCBI__GCF_000025505.1:WP_012965250.1 365 D 365 6 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (340 nodes) Target sequences: 1 (388 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 7.80 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory