Align Shikimate dehydrogenase (NADP(+)); SD; SDH; EC 1.1.1.25 (characterized)
to candidate WP_012992013.1 THAL_RS04965 shikimate dehydrogenase
Query= SwissProt::O67049 (269 letters) >NCBI__GCF_000025605.1:WP_012992013.1 Length = 259 Score = 282 bits (722), Expect = 4e-81 Identities = 138/259 (53%), Positives = 191/259 (73%), Gaps = 8/259 (3%) Query: 8 LYGVIGFPVKHSLSPVFQNALIRYAGLNAVYLAFEINPEELKKAFEGFKALKVKGINVTV 67 LYG+IG+PV HSLSPVFQN +RY G++A+Y+ FE+ PE+L +A +G K L V+G+NVT+ Sbjct: 3 LYGLIGYPVSHSLSPVFQNFALRYLGVDAIYVPFEVKPEDLSEAIKGLKVLGVRGVNVTI 62 Query: 68 PFKEEIIPLLDYVEDTAKEIGAVNTVKFENGKAYGYNTDWIGFLKSLKSLIPEVKEKSIL 127 P KE ++ L+D+++ + IGA NT+ E+G YNTDWIGFLKSL + ++ + L Sbjct: 63 PHKERVLDLVDWMDHHTEVIGAANTLLLEDGIIKAYNTDWIGFLKSLWDM--QLSKGKAL 120 Query: 128 VLGAGGASRAVIYALVKEGAKVFLWNRTKEKAIKLAQKFPLEVVNSPEEVIDKVQVIVNT 187 +LGAGG+SRAV YAL +EG +V+LWNRTKEKA+ LA++F L+VV+ PEEV+ V +IVNT Sbjct: 121 LLGAGGSSRAVAYALRQEGWEVYLWNRTKEKAVSLAERFQLQVVDRPEEVVKHVDLIVNT 180 Query: 188 TSVGLKDKDPEIFNYDLIKKDHVVVDII-YKETKLLKKAKEKGAKLFDGLPMLLWQGIEA 246 T + +F+Y LI H ++DII Y+ET L+++AKE GAK DGLPMLL+QG+E+ Sbjct: 181 T-----PSEEPLFDYQLIDSHHSILDIIYYRETALIRRAKEVGAKYSDGLPMLLYQGLES 235 Query: 247 FKIWNGCEVPYSVAERSVR 265 +IW GC VPY + SVR Sbjct: 236 LRIWTGCSVPYKLVLESVR 254 Lambda K H 0.318 0.138 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 269 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 269 Length of database: 259 Length adjustment: 25 Effective length of query: 244 Effective length of database: 234 Effective search space: 57096 Effective search space used: 57096 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate WP_012992013.1 THAL_RS04965 (shikimate dehydrogenase)
to HMM TIGR00507 (aroE: shikimate dehydrogenase (EC 1.1.1.25))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00507.hmm # target sequence database: /tmp/gapView.19607.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00507 [M=270] Accession: TIGR00507 Description: aroE: shikimate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-72 229.3 0.0 2.9e-72 229.0 0.0 1.0 1 lcl|NCBI__GCF_000025605.1:WP_012992013.1 THAL_RS04965 shikimate dehydroge Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000025605.1:WP_012992013.1 THAL_RS04965 shikimate dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 229.0 0.0 2.9e-72 2.9e-72 2 266 .. 3 254 .. 2 258 .. 0.95 Alignments for each domain: == domain 1 score: 229.0 bits; conditional E-value: 2.9e-72 TIGR00507 2 llgviGnpikhSksplihnaalkqlgleleYlafeveieelekalsgikalglkGvnvTvPfKeevlel 70 l+g+iG+p+ hS+sp+ +n al+ lg++ Y+ fev++e+l++a++g+k lg++GvnvT+P+Ke+vl+l lcl|NCBI__GCF_000025605.1:WP_012992013.1 3 LYGLIGYPVSHSLSPVFQNFALRYLGVDAIYVPFEVKPEDLSEAIKGLKVLGVRGVNVTIPHKERVLDL 71 79******************************************************************* PP TIGR00507 71 lDeieesakligavNTlkledgklvgynTDgiGlvssLeklsklksekrvliiGAGGaakavaleLlka 139 +D ++++ ++iga NTl ledg + +ynTD iG+++sL +l + ++l++GAGG+++ava +L ++ lcl|NCBI__GCF_000025605.1:WP_012992013.1 72 VDWMDHHTEVIGAANTLLLEDGIIKAYNTDWIGFLKSLWD-MQLS-KGKALLLGAGGSSRAVAYALRQE 138 **************************************99.5565.6889******************* PP TIGR00507 140 dkeviiaNRtvekaeelaerlqelgeilalsleevelkkvdliinatsaglsgeideaevkaellkegk 208 + ev + NRt+eka laer+q + ++ e k+vdli+n+t++ +e+ + +l+++ + lcl|NCBI__GCF_000025605.1:WP_012992013.1 139 GWEVYLWNRTKEKAVSLAERFQL----QVVDRPEEVVKHVDLIVNTTPS------EEPLFDYQLIDSHH 197 **********************9....888888999999********96......3566899******* PP TIGR00507 209 lvvDlvynpletpllkeakkkgtkvidGlgMlvaQaalsFelwtgvepdvekvfealk 266 ++D++y t+l++ ak++g+k +dGl Ml +Q++ s ++wtg +++ v e ++ lcl|NCBI__GCF_000025605.1:WP_012992013.1 198 SILDIIYYRE-TALIRRAKEVGAKYSDGLPMLLYQGLESLRIWTGCSVPYKLVLESVR 254 *******987.************************************99999888776 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (259 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 9.21 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory