GapMind for Amino acid biosynthesis

 

Alignments for a candidate for aroE in Thermocrinis albus DSM 14484

Align Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 (uncharacterized)
to candidate WP_012992396.1 THAL_RS06910 glutamyl-tRNA reductase

Query= curated2:A0B999
         (269 letters)



>NCBI__GCF_000025605.1:WP_012992396.1
          Length = 409

 Score = 46.6 bits (109), Expect = 9e-10
 Identities = 31/89 (34%), Positives = 48/89 (53%), Gaps = 3/89 (3%)

Query: 101 IGASLALRHYGVNVRGADVLLIGAGGAARAIAYQLSKDGAEIVVTNRTPERGLALASDLG 160
           +   LA R +G ++R A VLL+GAG  A+  A    K GA I ++NRT E+ + +A  L 
Sbjct: 164 VAVDLARRIFG-DLRKARVLLVGAGEMAQLAARYFRKMGASIFISNRTYEKAVDVAKSLD 222

Query: 161 LEFRPFGEIDDLVRVSDVVINATSVGMRD 189
                F E+ + +   D+V+   S G +D
Sbjct: 223 GNVIRFEELGEHLHTFDIVL--VSTGSKD 249


Lambda     K      H
   0.321    0.138    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 204
Number of extensions: 10
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 269
Length of database: 409
Length adjustment: 28
Effective length of query: 241
Effective length of database: 381
Effective search space:    91821
Effective search space used:    91821
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory