Align 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 (uncharacterized)
to candidate WP_013009414.1 DACET_RS00305 3-dehydroquinate synthase
Query= curated2:Q8RB14 (356 letters) >NCBI__GCF_000025725.1:WP_013009414.1 Length = 349 Score = 233 bits (595), Expect = 4e-66 Identities = 144/343 (41%), Positives = 191/343 (55%), Gaps = 12/343 (3%) Query: 1 MDEVIVELKERSYPIYFDYEGFDRVGDLIKKHVRSSKTFVITDSNVYPLYFEKIEESLRK 60 M V V LK+ Y G ++I+K +R+ F + D NV+ LY + Sbjct: 1 MKTVKVNLKKEVDTSYEITIGSSFAKEVIEK-MRAEGAFFMVDENVFELYSDLFTH---- 55 Query: 61 SGFDVLYEVIPAGETSKTMEMAQRLLEVAYDSGLLRDSSIIALGGGVVGDIAGFVAATYM 120 D + A E +KT E +L + G RDS + +GGG+ GD+ GFVAATYM Sbjct: 56 ---DNTFR-FRADEHNKTHESVVAVLGFLFREGAKRDSLLSIVGGGITGDVGGFVAATYM 111 Query: 121 RGIDFIQIPTTLLAQVDSSVGGKVAVNLKKGKNIVGAFYQPKMVYIDTSVLGTLNKREVL 180 RGI FIQ+PTTLL+ VDSSVGGK +N + KN VGAF QP+ VYID L TL E L Sbjct: 112 RGISFIQMPTTLLSMVDSSVGGKTGINFRGAKNNVGAFAQPEHVYIDMDFLNTLTDEEFL 171 Query: 181 GGLAEVIKYGVIWDFDLFTYIEENLGDILRLKKEDLTYIVKRSCEIKAKVVSLDEKEENL 240 G+AE+IKYG I+D D F Y+EE+ ++ E L+YIVKR CE+KA+VV DEKE Sbjct: 172 NGVAEIIKYGAIFDKDFFRYLEEHREQVIARDTETLSYIVKRCCEMKAEVVRKDEKERGD 231 Query: 241 RAILNFGHTIGHAIEALTGYERYIHGEAVAIGMAYEARLAFNLGYIDEGYLERILNLIKR 300 RA+LNFGHT HAIE + HG AVA GM E A G D+ LE I ++ Sbjct: 232 RALLNFGHTFAHAIET-DSHHGVKHGFAVATGMYLETDYAVRAGEADKETLEAIGRILTD 290 Query: 301 AGLPADYEGIEKTDMLNAIKLDKKMREGRINFVL--PVGLGKV 341 G Y+ ++ A++ DKK + ++ L +G GK+ Sbjct: 291 YGFALSYDIDDRELFFQAMQADKKAGKKGLSLALTPSIGSGKI 333 Lambda K H 0.320 0.141 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 371 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 349 Length adjustment: 29 Effective length of query: 327 Effective length of database: 320 Effective search space: 104640 Effective search space used: 104640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_013009414.1 DACET_RS00305 (3-dehydroquinate synthase)
to HMM TIGR01357 (aroB: 3-dehydroquinate synthase (EC 4.2.3.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01357.hmm # target sequence database: /tmp/gapView.30496.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01357 [M=344] Accession: TIGR01357 Description: aroB: 3-dehydroquinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.3e-105 337.1 0.3 7.3e-105 336.9 0.3 1.0 1 lcl|NCBI__GCF_000025725.1:WP_013009414.1 DACET_RS00305 3-dehydroquinate s Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000025725.1:WP_013009414.1 DACET_RS00305 3-dehydroquinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 336.9 0.3 7.3e-105 7.3e-105 1 341 [. 16 344 .. 16 347 .. 0.95 Alignments for each domain: == domain 1 score: 336.9 bits; conditional E-value: 7.3e-105 TIGR01357 1 ykvkvgegllkklveelaekasklvvitdeeveklvaekleealkslgvevlvlvvpdgeesKsletva 69 y++++g+++ k++ e+++ + +++++de+v +l+++ + + + ++ + + e++K+ e+v lcl|NCBI__GCF_000025725.1:WP_013009414.1 16 YEITIGSSFAKEVIEKMRA--EGAFFMVDENVFELYSDLFTHDN--------TFRFRADEHNKTHESVV 74 6789999999988888885..78999********9988776555........68999************ PP TIGR01357 70 klldqlleeklerksvlvaiGGGvvgDlaGFvAatylRGirlvqvPTtllamvDssvGGKtginlplgk 138 ++l l++e+++r+s+l ++GGG+ gD++GFvAaty+RGi+++q+PTtll+mvDssvGGKtgin+++ k lcl|NCBI__GCF_000025725.1:WP_013009414.1 75 AVLGFLFREGAKRDSLLSIVGGGITGDVGGFVAATYMRGISFIQMPTTLLSMVDSSVGGKTGINFRGAK 143 ********************************************************************* PP TIGR01357 139 NliGafyqPkaVlidlkvletlperelreGmaEviKhgliadaelfeelekneklllklaelealeeli 207 N +Gaf qP+ V+id+++l+tl+++e+ +G+aE+iK+g+i d+++f+ le++ +++ + ++e+l+ ++ lcl|NCBI__GCF_000025725.1:WP_013009414.1 144 NNVGAFAQPEHVYIDMDFLNTLTDEEFLNGVAEIIKYGAIFDKDFFRYLEEHREQVIAR-DTETLSYIV 211 ******************************************************98875.56******* PP TIGR01357 208 krsievKaevVeeDekesglRalLNfGHtlgHaiEallkyklsHGeaVaiGmvveaklseklgllkael 276 kr++e+KaevV +Deke+g RalLNfGHt++HaiE+ ++++++HG aVa+Gm +e+ ++ ++g +++e lcl|NCBI__GCF_000025725.1:WP_013009414.1 212 KRCCEMKAEVVRKDEKERGDRALLNFGHTFAHAIETDSHHGVKHGFAVATGMYLETDYAVRAGEADKET 280 ********************************************************************* PP TIGR01357 277 lerlvallkklglptklkkklsveellkallkDKKnegskiklvlleeiGkaalasevteeelle 341 le + ++l +g ++ + e +++a++ DKK+ ++ + l l +iG+ ++ ++++++ + + lcl|NCBI__GCF_000025725.1:WP_013009414.1 281 LEAIGRILTDYGFALSYD-IDDRELFFQAMQADKKAGKKGLSLALTPSIGSGKILKNIPQQSVVD 344 *****************9.5999*****************************9999999888765 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (344 nodes) Target sequences: 1 (349 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.52 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory