Align Chorismate synthase; CS; 5-enolpyruvylshikimate-3-phosphate phospholyase; EPSP phospholyase; EC 4.2.3.5 (characterized)
to candidate WP_013011105.1 DACET_RS09220 chorismate synthase
Query= SwissProt::P12008 (361 letters) >NCBI__GCF_000025725.1:WP_013011105.1 Length = 356 Score = 374 bits (959), Expect = e-108 Identities = 188/349 (53%), Positives = 251/349 (71%), Gaps = 1/349 (0%) Query: 1 MAGNTIGQLFRVTTFGESHGLALGCIVDGVPPGIPLTEADLQHDLDRRRPGTSRYTTQRR 60 MAG+T G F +TTFGESHG A+G ++DG PP I L+ D+Q +LDRRRPG S+ +T R Sbjct: 1 MAGSTFGTNFTITTFGESHGKAVGVVLDGCPPMIELSVEDVQKELDRRRPGQSKVSTPRD 60 Query: 61 EPDQVKILSGVFEGVTTGTSIGLLIENTDQRSQDYSAIKDVFRPGHADYTYEQKYGLRDY 120 E D V+I SG+FEG TTGT I +++ N +Q S+DY+A+KD+FRPGHAD+TY KYG+RD+ Sbjct: 61 ESDTVEIYSGIFEGKTTGTPIMMMVFNKNQMSRDYNAVKDLFRPGHADFTYYSKYGVRDH 120 Query: 121 RGGGRSSARETAMRVAAGAIAKKYLAEKFGIEIRGCLTQMGDIPLDIKDWSQVEQNPFFC 180 RGGGRSSARET RV AGA+AKK L+ G+ I+ + Q+G + +D VE+N Sbjct: 121 RGGGRSSARETIGRVCAGAVAKKILSRS-GVTIQAYVIQVGPHKAEKRDLGIVEENIIRT 179 Query: 181 PDPDKIDALDELMRALKKEGDSIGAKVTVVASGVPAGLGEPVFDRLDADIAHALMSINAV 240 D D ++E + K+ GDS+GA V V+ GVP G+GEPVFDRL+A I+HA+MSI AV Sbjct: 180 CDLDAAKKMEEYIVEAKEAGDSVGAIVEVIVKGVPVGVGEPVFDRLNALISHAIMSIPAV 239 Query: 241 KGVEIGDGFDVVALRGSQNRDEITKDGFQSNHAGGILGGISSGQQIIAHMALKPTSSITV 300 KG+E G GF+ +RGS++ DE+ K GF SN+AGG LGG++SGQ II +KP SSITV Sbjct: 240 KGIEFGKGFEAALMRGSEHNDEMIKYGFLSNNAGGTLGGMASGQDIIFRFVVKPASSITV 299 Query: 301 PGRTINRFGEEVEMITKGRHDPCVGIRAVPIAEAMLAIVLMDHLLRQRA 349 P + I+ +G E +IT+GRHDPCV R VP+AEAM +VL+D ++ +A Sbjct: 300 PRKGIDLYGNEKTVITEGRHDPCVAPRVVPVAEAMTGVVLVDLIMSDKA 348 Lambda K H 0.319 0.138 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 384 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 356 Length adjustment: 29 Effective length of query: 332 Effective length of database: 327 Effective search space: 108564 Effective search space used: 108564 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_013011105.1 DACET_RS09220 (chorismate synthase)
to HMM TIGR00033 (aroC: chorismate synthase (EC 4.2.3.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00033.hmm # target sequence database: /tmp/gapView.20023.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00033 [M=351] Accession: TIGR00033 Description: aroC: chorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.4e-138 444.9 3.9 1.1e-137 444.7 3.9 1.0 1 lcl|NCBI__GCF_000025725.1:WP_013011105.1 DACET_RS09220 chorismate synthas Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000025725.1:WP_013011105.1 DACET_RS09220 chorismate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 444.7 3.9 1.1e-137 1.1e-137 1 348 [. 10 347 .. 10 350 .. 0.97 Alignments for each domain: == domain 1 score: 444.7 bits; conditional E-value: 1.1e-137 TIGR00033 1 lrlttfGeSHgkalgaiidGlPaglelteediqkelkrRrpgqsrltrmrkEeDeveilsGvfeGkTtG 69 +++ttfGeSHgka+g+++dG+P+ +el+ ed+qkel+rRrpgqs+++++r+E+D+vei sG+feGkTtG lcl|NCBI__GCF_000025725.1:WP_013011105.1 10 FTITTFGESHGKAVGVVLDGCPPMIELSVEDVQKELDRRRPGQSKVSTPRDESDTVEIYSGIFEGKTTG 78 789****************************************************************** PP TIGR00033 70 aPiallikNkdvrskdyedikelpRPgHadytylkKYgikdregggrsSaReTaarvaaGavakklLke 138 +Pi +++ Nk++ s+dy+ +k+l+RPgHad+ty KYg++d++gggrsSaReT++rv aGavakk L++ lcl|NCBI__GCF_000025725.1:WP_013011105.1 79 TPIMMMVFNKNQMSRDYNAVKDLFRPGHADFTYYSKYGVRDHRGGGRSSARETIGRVCAGAVAKKILSR 147 ********************************************************************* PP TIGR00033 139 tagieivayvvklgeveleeesakeiskerldkspvrcpdaeaekemeeeidkakkdgdsvGgvvevvv 207 +g+ i ayv+++g ++e++ ++++ +r d +a+k+mee+i +ak++gdsvG++vev+v lcl|NCBI__GCF_000025725.1:WP_013011105.1 148 -SGVTIQAYVIQVGPHKAEKRDLG-----IVEENIIRTCDLDAAKKMEEYIVEAKEAGDSVGAIVEVIV 210 .99************999975554.....5888999********************************* PP TIGR00033 208 snvpvglGeplfdkldaelasallsinAvKgveiGdGFeaasvrGseanDelvleddkirrktnnsGGi 276 ++vpvg+Gep+fd+l+a +++a++si+AvKg+e+G+GFeaa +rGse+nDe+ k+ + +nn GG+ lcl|NCBI__GCF_000025725.1:WP_013011105.1 211 KGVPVGVGEPVFDRLNALISHAIMSIPAVKGIEFGKGFEAALMRGSEHNDEMI----KYGFLSNNAGGT 275 **************************************************886....899********* PP TIGR00033 277 eGGitnGedirvriavKpiptikkplktvdletkekakatkgRhDpcvvpravpvvEamvalvladall 345 +GG++ G+di +r +vKp ++i+ p+k +dl ++ek+ +t+gRhDpcv+pr+vpv+Eam+ +vl+d+++ lcl|NCBI__GCF_000025725.1:WP_013011105.1 276 LGGMASGQDIIFRFVVKPASSITVPRKGIDLYGNEKTVITEGRHDPCVAPRVVPVAEAMTGVVLVDLIM 344 *******************************************************************99 PP TIGR00033 346 ekr 348 +++ lcl|NCBI__GCF_000025725.1:WP_013011105.1 345 SDK 347 876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (356 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.54 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory