Align Homoserine O-acetyltransferase; HAT; Homoserine transacetylase; HTA; EC 2.3.1.31 (characterized)
to candidate WP_041277703.1 DP_RS06275 homoserine O-acetyltransferase
Query= SwissProt::C4XNQ9 (397 letters) >NCBI__GCF_000025945.1:WP_041277703.1 Length = 390 Score = 461 bits (1187), Expect = e-134 Identities = 217/372 (58%), Positives = 283/372 (76%), Gaps = 3/372 (0%) Query: 13 SVGRVEKRFFTVAEADSPLTVESGRALGPVVLAYETCGQLNERADNAVLVLHALTGDSHA 72 SVG VEK+FFT A+ SPL +E+G LGP+ +AYET G L+ R DNA+L+ HA +GDSH Sbjct: 10 SVGIVEKQFFTCAQVPSPLILENGAKLGPITIAYETYGNLSARKDNAILINHAFSGDSHV 69 Query: 73 AGYY--EPGDAKPGWWDLMIGPGKPIDTDRYYVICSNVIGGCMGSTGPSSLDPATGQPYG 130 AG+Y + KPGWWD ++GPGK IDTD+Y++ICSN++G C G+TGP+S + TG+ Y Sbjct: 70 AGHYATDGPKEKPGWWDFLVGPGKGIDTDKYFIICSNILGSCNGTTGPASKNSETGEAYA 129 Query: 131 LTFPVITIGDMVRAQKRLVEHLGVTKLLSVVGGSMGGMQALEWSVRYPDMVRTAVPLATT 190 L FP++TIGDMV QK L++HLG+ KLL+V+GGS+GGMQ LEW++RYP+M+ + +P+ATT Sbjct: 130 LDFPMVTIGDMVATQKLLIDHLGIPKLLAVIGGSVGGMQTLEWAIRYPEMMHSVIPIATT 189 Query: 191 TKHSALAIAFNEVARQAIMADPNWNGGNYYDGVPPAHGLAVGRMIGHITYLSDEAMRQKF 250 +HSALAIAFNE+ARQAIM DP+WN G YY P GLAV RM+GH+TYLSDEAMR+KF Sbjct: 190 MRHSALAIAFNEIARQAIMTDPHWNRGKYYGQAHPDTGLAVARMVGHVTYLSDEAMRRKF 249 Query: 251 DRRLQDRCENSFVLEEPDFQVESYLRYQGQKFVDRFDANSFLYITKAADYFNLEASHGCG 310 R LQ++ EN + DFQVESYLRYQG KFV RFDANS LYITKA+DYF++ Sbjct: 250 GRNLQEK-ENLSYGFDADFQVESYLRYQGNKFVHRFDANSLLYITKASDYFDIVERISTS 308 Query: 311 SAVAAFAKAKCRYLVASFSSDWLYPTYQSRSMVQAMKKNGLDVSFVELEAKWGHDAFLLP 370 + +YLV S+SSDWLYPTYQ+R +V+A+K++G +VSF E+E+ GHDAFL+P Sbjct: 309 GPETELTAPQQKYLVISYSSDWLYPTYQARDLVKALKRSGRNVSFSEIESDCGHDAFLIP 368 Query: 371 NARLSGMIARFL 382 + RL ++ FL Sbjct: 369 DDRLEQLMRGFL 380 Lambda K H 0.320 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 482 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 390 Length adjustment: 31 Effective length of query: 366 Effective length of database: 359 Effective search space: 131394 Effective search space used: 131394 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate WP_041277703.1 DP_RS06275 (homoserine O-acetyltransferase)
to HMM TIGR01392 (metX: homoserine O-acetyltransferase (EC 2.3.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01392.hmm # target sequence database: /tmp/gapView.6270.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01392 [M=351] Accession: TIGR01392 Description: homoserO_Ac_trn: homoserine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-141 456.6 0.0 3.3e-141 456.3 0.0 1.0 1 lcl|NCBI__GCF_000025945.1:WP_041277703.1 DP_RS06275 homoserine O-acetyltr Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000025945.1:WP_041277703.1 DP_RS06275 homoserine O-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 456.3 0.0 3.3e-141 3.3e-141 3 350 .. 26 380 .. 24 381 .. 0.97 Alignments for each domain: == domain 1 score: 456.3 bits; conditional E-value: 3.3e-141 TIGR01392 3 eeltlesGevlsevevayktyGtlnaerdNavlvcHaltgsahvagkadeedk....GWWdellGpgra 67 ++l le+G++l +++ay+tyG+l+a++dNa+l+ Ha++g++hvag++ ++ + GWWd l+Gpg+ lcl|NCBI__GCF_000025945.1:WP_041277703.1 26 SPLILENGAKLGPITIAYETYGNLSARKDNAILINHAFSGDSHVAGHYATDGPkekpGWWDFLVGPGKG 94 5799******************************************99877656788************ PP TIGR01392 68 ldtsryfvvclNvlGsckGstgPlsinpetgkpygaefPlvtirDlvkaqkalldsLgveklaavvGgS 136 +dt++yf++c+N lGsc+G+tgP+s n etg+ y +fP+vti D+v +qk l+d+Lg+ kl av+GgS lcl|NCBI__GCF_000025945.1:WP_041277703.1 95 IDTDKYFIICSNILGSCNGTTGPASKNSETGEAYALDFPMVTIGDMVATQKLLIDHLGIPKLLAVIGGS 163 ********************************************************************* PP TIGR01392 137 lGGmqalewalsypervkkivvlatsarasaqaiafnevqrqailsDpeyndGeyaeeeqPekGLalAR 205 +GGmq+lewa++ype++++++++at++r+sa aiafne++rqai++Dp++n G+y+ + +P++GLa+AR lcl|NCBI__GCF_000025945.1:WP_041277703.1 164 VGGMQTLEWAIRYPEMMHSVIPIATTMRHSALAIAFNEIARQAIMTDPHWNRGKYYGQAHPDTGLAVAR 232 ********************************************************************* PP TIGR01392 206 mlalltYrseesleerfgreakseeslassleeefsvesylryqgkkfverFdAnsYllltkaldthdl 274 m++++tY+s+e+++++fgr+ +++e+l++ ++++f+vesylryqg+kfv+rFdAns l++tka d++d+ lcl|NCBI__GCF_000025945.1:WP_041277703.1 233 MVGHVTYLSDEAMRRKFGRNLQEKENLSYGFDADFQVESYLRYQGNKFVHRFDANSLLYITKASDYFDI 301 ********************************************************************9 PP TIGR01392 275 argr.rdslkealkkikapvlvvgiesDllftleeqeelakalkaakle..yaeieseeGHDaFlleke 340 + + + + l++ ++++lv++++sD+l+++ ++++l+kalk+++ + + eies+ GHDaFl+ ++ lcl|NCBI__GCF_000025945.1:WP_041277703.1 302 VERIsTSGPETELTAPQQKYLVISYSSDWLYPTYQARDLVKALKRSGRNvsFSEIESDCGHDAFLIPDD 370 987646678889*********************************999889****************** PP TIGR01392 341 kveelirefl 350 ++e+l+r fl lcl|NCBI__GCF_000025945.1:WP_041277703.1 371 RLEQLMRGFL 380 ******9997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (390 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 7.47 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory