Align 3-dehydroquinate synthase (EC 4.2.3.4) (characterized)
to candidate WP_011606336.1 FRAAL_RS22880 3-dehydroquinate synthase
Query= BRENDA::P9WPX9 (362 letters) >NCBI__GCF_000058485.1:WP_011606336.1 Length = 371 Score = 383 bits (984), Expect = e-111 Identities = 202/356 (56%), Positives = 249/356 (69%), Gaps = 12/356 (3%) Query: 8 VTVQVAVDPPYPVVIGTGLLDELEDLLADRHKVAVVHQPGLAETAEEIRKRL-AGKGVDA 66 + V+ + Y VV+G GLL +L + +A R + AV+H L TA+ + L A GV+A Sbjct: 13 IPVRPGGERAYDVVLGEGLLGDLAETVAGRTRAAVIHPAALRTTADAVVADLRANAGVEA 72 Query: 67 HRIEIPDAEAGKDLPVVGFIWEVLGRIGIGRKDALVSLGGGAATDVAGFAAATWLRGVSI 126 H +E+PD E K L + GF W+VLGRIG R D ++ LGGG TD+AGF AA+WLRGV + Sbjct: 73 HAVEVPDGEEAKQLRIAGFCWDVLGRIGFTRDDVIIGLGGGTVTDLAGFVAASWLRGVDV 132 Query: 127 VHLPTTLLGMVDAAVGGKTGINTDAGKNLVGAFHQPLAVLVDLATLQTLPRDEMICGMAE 186 V +PTT+LGMVDAAVGGKTG++ DAGKNLVGAFHQPL VL DLA L TLP E+ G+AE Sbjct: 133 VQVPTTVLGMVDAAVGGKTGVDIDAGKNLVGAFHQPLTVLCDLAALATLPAVEVRAGLAE 192 Query: 187 VVKAGFIADPVILDLIEADPQAALDPAGDVLPELIRRAITVKAEVVAADEKESELREILN 246 VVK GFIAD ILDL++ DP A LPEL+ R+I VKAEVV+ D +E+ REILN Sbjct: 193 VVKTGFIADAAILDLLDDDPTGAAH-----LPELVERSIRVKAEVVSGDPREAGRREILN 247 Query: 247 YGHTLGHAIERRERYRWRHGAAVSVGLVFAAELARLAGRLDDATAQRHRTILSSLGLPVS 306 YGHTLGHAIE+ E + WRHGAA+SVG+VFAAEL+RL LDDATA RHR +L+ +GLPVS Sbjct: 248 YGHTLGHAIEKVEHFTWRHGAAISVGMVFAAELSRLVAGLDDATADRHRELLTRIGLPVS 307 Query: 307 YDPDALPQLLEIMAGDKKTRAGVLRFVVLDGLAKPGRMV---GPDPGLLVTAYAGV 359 Y D P LL+ M DKK+R LRF+ GLA G V PD GLL+ A+ V Sbjct: 308 YRGDRWPALLDAMRVDKKSRGRRLRFI---GLAAQGETVILDSPDTGLLIAAFTAV 360 Lambda K H 0.320 0.139 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 495 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 371 Length adjustment: 30 Effective length of query: 332 Effective length of database: 341 Effective search space: 113212 Effective search space used: 113212 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_011606336.1 FRAAL_RS22880 (3-dehydroquinate synthase)
to HMM TIGR01357 (aroB: 3-dehydroquinate synthase (EC 4.2.3.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01357.hmm # target sequence database: /tmp/gapView.25337.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01357 [M=344] Accession: TIGR01357 Description: aroB: 3-dehydroquinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-108 348.8 0.0 2e-108 348.6 0.0 1.0 1 lcl|NCBI__GCF_000058485.1:WP_011606336.1 FRAAL_RS22880 3-dehydroquinate s Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000058485.1:WP_011606336.1 FRAAL_RS22880 3-dehydroquinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 348.6 0.0 2e-108 2e-108 1 331 [. 23 345 .. 23 354 .. 0.97 Alignments for each domain: == domain 1 score: 348.6 bits; conditional E-value: 2e-108 TIGR01357 1 ykvkvgegllkklveelaekasklvvitdeeveklvaekleealkslgvevlvlvvpdgeesKsletva 69 y+v++gegll l+e++a ++++ vi+ ++++++++ ++++++++gve++ + vpdgee+K+l+ + lcl|NCBI__GCF_000058485.1:WP_011606336.1 23 YDVVLGEGLLGDLAETVAG-RTRAAVIHPAALRTTADAVVADLRANAGVEAHAVEVPDGEEAKQLRIAG 90 7899**************7.678999999999999********************************** PP TIGR01357 70 klldqlleeklerksvlvaiGGGvvgDlaGFvAatylRGirlvqvPTtllamvDssvGGKtginlplgk 138 ++d l + +++r++v++++GGG+v+DlaGFvAa++lRG+++vqvPTt+l+mvD++vGGKtg++ + gk lcl|NCBI__GCF_000058485.1:WP_011606336.1 91 FCWDVLGRIGFTRDDVIIGLGGGTVTDLAGFVAASWLRGVDVVQVPTTVLGMVDAAVGGKTGVDIDAGK 159 ********************************************************************* PP TIGR01357 139 NliGafyqPkaVlidlkvletlperelreGmaEviKhgliadaelfeelekneklllklaelealeeli 207 Nl+Gaf+qP +Vl+dl+ l+tlp e+r+G+aEv+K+g+iada++++ l + ++l el+ lcl|NCBI__GCF_000058485.1:WP_011606336.1 160 NLVGAFHQPLTVLCDLAALATLPAVEVRAGLAEVVKTGFIADAAILDLLDDDPT------GAAHLPELV 222 *************************************************99665......2479***** PP TIGR01357 208 krsievKaevVeeDekesglRalLNfGHtlgHaiEallkyklsHGeaVaiGmvveaklseklgllkael 276 +rsi+vKaevV+ D++e+g R++LN+GHtlgHaiE++ +++++HG a+++Gmv++a+ls+ ++ l+ lcl|NCBI__GCF_000058485.1:WP_011606336.1 223 ERSIRVKAEVVSGDPREAGRREILNYGHTLGHAIEKVEHFTWRHGAAISVGMVFAAELSRLVAGLDDAT 291 ********************************************************************* PP TIGR01357 277 lerlvallkklglptklkkklsveellkallkDKKnegskiklvlleeiGkaala 331 ++r+++ll ++glp++++ + +ll+a+ DKK++g +++++ l + G++++ lcl|NCBI__GCF_000058485.1:WP_011606336.1 292 ADRHRELLTRIGLPVSYRG-DRWPALLDAMRVDKKSRGRRLRFIGLAAQGETVIL 345 ******************7.999***********************999998775 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (344 nodes) Target sequences: 1 (371 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 11.99 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory