Align shikimate dehydrogenase (NADP+) (EC 1.1.1.25) (characterized)
to candidate WP_083867038.1 FRAAL_RS22900 shikimate dehydrogenase
Query= BRENDA::A0A045GU47 (269 letters) >NCBI__GCF_000058485.1:WP_083867038.1 Length = 313 Score = 168 bits (425), Expect = 1e-46 Identities = 114/277 (41%), Positives = 151/277 (54%), Gaps = 16/277 (5%) Query: 5 PKKAGVLGSPIAHSRSPQLHLAAYRALGLHDWTYERIECGAAELPVVVGGF--GPEWVGV 62 P +A VLG+P+ HS SP LH AAY LGL TY I C A+ELP ++ P+WVG+ Sbjct: 22 PVRAAVLGAPVDHSLSPVLHAAAYAELGLAV-TYTAIHCDASELPAMMERVRSDPDWVGL 80 Query: 63 SVTMPGKFAALRFADERTARADLVGSANTLVRTPHG-WRADNTDIDGVAGAL-----GAA 116 S+TMP K + DE A +G+ NT+V G NTD+ G+ AL GA Sbjct: 81 SLTMPLKTVVVDLLDEVDPTAAAIGAVNTVVVGEAGRLHGYNTDVVGIGVALRRVMRGAV 140 Query: 117 AGHALVLGSGGTAPAAVVGLAELGVTDITVVARNSDKAARLVDLGTRVGVATRFCAFD-- 174 G L+LG+GGTA AAV +A G + VVAR + A + +G R+GV ++ Sbjct: 141 PGQPLILGAGGTARAAVAAVAAAGCPHVAVVARRPEAVAEVARIGARLGVEVTALPWELL 200 Query: 175 SGGLADAVAAAEVLVSTIPAEVAAGYAGTL-AAIPVLLDAIYDPWPTPLAAAVGSAGGRV 233 +GGL A +++++T PA A A L++ +Y PWPT LAAA AG RV Sbjct: 201 AGGLP---AGPDLVIATTPAGATDPLATRRWPASSQLVELLYHPWPTALAAAAYRAGARV 257 Query: 234 ISGLQMLLHQAFAQVEQFTGLPAPREA-MTCALAALD 269 SGL++L QA QVE FTG P +T AALD Sbjct: 258 ASGLEILAAQAVGQVEHFTGRRVPAGVLLTAGQAALD 294 Lambda K H 0.319 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 291 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 269 Length of database: 313 Length adjustment: 26 Effective length of query: 243 Effective length of database: 287 Effective search space: 69741 Effective search space used: 69741 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory