Align Phosphoserine phosphatase SerB1; PSP; PSPase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 (characterized)
to candidate WP_041938828.1 FRAAL_RS04200 HAD-IB family hydrolase
Query= SwissProt::P9WGJ3 (308 letters) >NCBI__GCF_000058485.1:WP_041938828.1 Length = 293 Score = 305 bits (781), Expect = 8e-88 Identities = 158/264 (59%), Positives = 196/264 (74%), Gaps = 1/264 (0%) Query: 44 AAGSDRQPPIDLTAAAFFDVDNTLVQGSSAVHFGRGLAARHYFTYRDVLGFLYAQAKFQL 103 AA +PP+D +AAAFFDVDNT++ G+S +F RGLAAR +F RD+L F + ++L Sbjct: 26 AAEEVPRPPLDESAAAFFDVDNTMMAGASIFYFARGLAARDFFDSRDLLRFGWQHVTYRL 85 Query: 104 LGKENSNDVAAGRRKALAFIEGRSVAELVALGEEIYDEIIADKIWDGTRELTQMHLDAGQ 163 G EN + + R ALAF+ GRSVAE+V GEEIYDE +A++I+ G L Q HLDAGQ Sbjct: 86 RGHENPDGMRDARETALAFVAGRSVAEIVRYGEEIYDERMAEQIYSGAHALAQQHLDAGQ 145 Query: 164 QVWLITATPYELAATIARRLGLTGALGTVAESVDGIFTGRLVGEILHGTGKAHAVRSLAI 223 +VWL+TATP ELA+ IARRL LTGALGTV+E DG +TG LVG +LHG KA AV++LA Sbjct: 146 RVWLVTATPVELASVIARRLSLTGALGTVSEVTDGTYTGHLVGGLLHGQAKAEAVQALAE 205 Query: 224 REGLNLKRCTAYSDSYNDVPMLSLVGTAVAINPDARLRSLARERGWEIRDFRIARKAARI 283 REGL+L RC AYSDS ND+PMLSLVG VAINPD L+++ARER W I+DFR ARKA RI Sbjct: 206 REGLDLSRCWAYSDSINDLPMLSLVGHPVAINPDPDLKTVAREREWPIKDFRTARKAVRI 265 Query: 284 GVPSALALGA-AGGALAALASRRQ 306 G+P+A GA AGG A +A RR+ Sbjct: 266 GIPAAAGAGALAGGVAAGMALRRR 289 Lambda K H 0.319 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 270 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 293 Length adjustment: 27 Effective length of query: 281 Effective length of database: 266 Effective search space: 74746 Effective search space used: 74746 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory