Align branched-chain-amino-acid transaminase (EC 2.6.1.42) (characterized)
to candidate WP_011605777.1 FRAAL_RS20360 branched chain amino acid aminotransferase
Query= BRENDA::F0QW25 (314 letters) >NCBI__GCF_000058485.1:WP_011605777.1 Length = 342 Score = 127 bits (319), Expect = 4e-34 Identities = 89/293 (30%), Positives = 143/293 (48%), Gaps = 15/293 (5%) Query: 17 VWVNGKLIPEKEATIPILTHALHYGTSIFEGIRAY-WNSDNNNLYVFRARDHYVRFHDSA 75 V+ +L+P + AT+P+ + AL YG S+FEG+R Y + L + H R +S Sbjct: 20 VYHREQLVPAQAATLPVGSIALRYGISVFEGVRLYRQEAPGLGLRPWLLDQHLDRLRNSC 79 Query: 76 KIMSIKVGYSVDELIDATVELLRANDVHEDVYIR-PITFVSASTVNLDIRNLDVTTAIIT 134 ++M + D++ EL+ ND D Y R ++ V A + D + A +T Sbjct: 80 RLMLLD-DTCCDDVPRIIDELVAVNDTQVDSYARIAVSAVDAGGIG------DGSEAALT 132 Query: 135 V---PFGH---YLEPKGIKAKVVSWLRVHNSMFPMKAKVSGIYVNSVIAIIDAKVSGFDE 188 V P G + +G++ V SW R +++FP AK Y +A+ A +GFD Sbjct: 133 VSVTPSGRKRWLRDGEGLRLTVSSWQRPSSAVFPSAAKNISAYAGPRLALAQAVAAGFDS 192 Query: 189 AILLNRDGYVAEGSGENIFIIKDGILYTPPVYDSILEGITRDTVITIARDLGLTVTEKRI 248 +L +G V+E +F+ + L TP + D++L GI+R V+ A LGL+V E+ + Sbjct: 193 CLLCTAEGLVSEAPTATVFLAEGTRLVTPRLGDAVLPGISRAWVLATAPRLGLSVAEEAV 252 Query: 249 TREELYTADEVFFTGTAAEVTPVVNIDGRVIGNGEPGPIALKVRSYYMDVVHG 301 T + + ADEVF GT E PV ++G P ++ + Y D V G Sbjct: 253 TPDRIRQADEVFLCGTGIEFGPVREVEGYTPARWPQRPATAQLVAAYFDQVRG 305 Lambda K H 0.321 0.139 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 242 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 342 Length adjustment: 28 Effective length of query: 286 Effective length of database: 314 Effective search space: 89804 Effective search space used: 89804 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory